BLASTX nr result
ID: Mentha25_contig00040973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040973 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006574365.1| PREDICTED: uncharacterized protein LOC100527... 67 3e-09 ref|XP_004491147.1| PREDICTED: 50S ribosomal protein L20-like is... 67 3e-09 ref|XP_004293880.1| PREDICTED: 50S ribosomal protein L20-like is... 67 3e-09 ref|NP_001235366.1| uncharacterized protein LOC100527387 [Glycin... 67 3e-09 ref|XP_006383403.1| ribosomal protein L20 [Populus trichocarpa] ... 67 3e-09 ref|XP_004139908.1| PREDICTED: 50S ribosomal protein L20-like is... 67 4e-09 ref|XP_006654683.1| PREDICTED: 50S ribosomal protein L20, chloro... 66 5e-09 ref|XP_007138298.1| hypothetical protein PHAVU_009G196700g [Phas... 66 5e-09 ref|XP_006425198.1| hypothetical protein CICLE_v10029584mg [Citr... 66 5e-09 ref|XP_004969858.1| PREDICTED: 50S ribosomal protein L20, chloro... 66 5e-09 ref|XP_007023565.1| Ribosomal protein L20 [Theobroma cacao] gi|5... 66 5e-09 gb|EMT06821.1| 50S ribosomal protein L20 [Aegilops tauschii] 66 5e-09 ref|XP_007212231.1| hypothetical protein PRUPE_ppa013387mg [Prun... 66 5e-09 gb|ADR71306.1| 50S ribosomal protein L20 [Hevea brasiliensis] 66 5e-09 dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 5e-09 ref|XP_002456306.1| hypothetical protein SORBIDRAFT_03g033790 [S... 66 5e-09 ref|XP_002530749.1| 50S ribosomal protein L20, putative [Ricinus... 66 5e-09 ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays] gi|2269... 66 5e-09 gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indi... 66 5e-09 ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group] g... 66 5e-09 >ref|XP_006574365.1| PREDICTED: uncharacterized protein LOC100527387 isoform X1 [Glycine max] gi|571437877|ref|XP_006574366.1| PREDICTED: uncharacterized protein LOC100527387 isoform X2 [Glycine max] Length = 121 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSEISMHEPY 93 >ref|XP_004491147.1| PREDICTED: 50S ribosomal protein L20-like isoform X1 [Cicer arietinum] gi|502098070|ref|XP_004491148.1| PREDICTED: 50S ribosomal protein L20-like isoform X2 [Cicer arietinum] Length = 121 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSEISMHEPY 93 >ref|XP_004293880.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Fragaria vesca subsp. vesca] gi|470115381|ref|XP_004293881.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Fragaria vesca subsp. vesca] Length = 124 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSEISMHEPY 93 >ref|NP_001235366.1| uncharacterized protein LOC100527387 [Glycine max] gi|255632234|gb|ACU16475.1| unknown [Glycine max] Length = 121 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSEISMHEPY 93 >ref|XP_006383403.1| ribosomal protein L20 [Populus trichocarpa] gi|550339013|gb|ERP61200.1| ribosomal protein L20 [Populus trichocarpa] Length = 126 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSEISMHEPY 93 >ref|XP_004139908.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis sativus] gi|449444292|ref|XP_004139909.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis sativus] gi|449444294|ref|XP_004139910.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis sativus] gi|449444296|ref|XP_004139911.1| PREDICTED: 50S ribosomal protein L20-like isoform 4 [Cucumis sativus] gi|449475856|ref|XP_004154571.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis sativus] gi|449475859|ref|XP_004154572.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis sativus] gi|449475863|ref|XP_004154573.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis sativus] Length = 125 Score = 66.6 bits (161), Expect = 4e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKEN+QLNRKVL+EISMHEPY Sbjct: 63 VNYGNFMHGLMKENVQLNRKVLSEISMHEPY 93 >ref|XP_006654683.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform X1 [Oryza brachyantha] gi|573944675|ref|XP_006654684.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform X2 [Oryza brachyantha] Length = 120 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_007138298.1| hypothetical protein PHAVU_009G196700g [Phaseolus vulgaris] gi|561011385|gb|ESW10292.1| hypothetical protein PHAVU_009G196700g [Phaseolus vulgaris] Length = 121 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_006425198.1| hypothetical protein CICLE_v10029584mg [Citrus clementina] gi|568870876|ref|XP_006488621.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Citrus sinensis] gi|557527132|gb|ESR38438.1| hypothetical protein CICLE_v10029584mg [Citrus clementina] Length = 125 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_004969858.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria italica] Length = 121 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_007023565.1| Ribosomal protein L20 [Theobroma cacao] gi|508778931|gb|EOY26187.1| Ribosomal protein L20 [Theobroma cacao] Length = 125 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >gb|EMT06821.1| 50S ribosomal protein L20 [Aegilops tauschii] Length = 122 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_007212231.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|595877140|ref|XP_007212232.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|596292982|ref|XP_007226592.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica] gi|462408096|gb|EMJ13430.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|462408097|gb|EMJ13431.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|462423528|gb|EMJ27791.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica] Length = 125 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >gb|ADR71306.1| 50S ribosomal protein L20 [Hevea brasiliensis] Length = 125 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 122 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_002456306.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor] gi|241928281|gb|EES01426.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor] Length = 121 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|XP_002530749.1| 50S ribosomal protein L20, putative [Ricinus communis] gi|223529713|gb|EEF31655.1| 50S ribosomal protein L20, putative [Ricinus communis] Length = 224 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays] gi|226958655|ref|NP_001152923.1| LOC100280565 [Zea mays] gi|242091177|ref|XP_002441421.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor] gi|514747670|ref|XP_004961424.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria italica] gi|195605838|gb|ACG24749.1| 50S ribosomal protein L20 [Zea mays] gi|195649829|gb|ACG44382.1| 50S ribosomal protein L20 [Zea mays] gi|241946706|gb|EES19851.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor] gi|413949894|gb|AFW82543.1| 50S ribosomal protein L20 isoform 1 [Zea mays] gi|413949895|gb|AFW82544.1| 50S ribosomal protein L20 isoform 2 [Zea mays] Length = 122 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93 >gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indica Group] gi|222632308|gb|EEE64440.1| hypothetical protein OsJ_19285 [Oryza sativa Japonica Group] Length = 151 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 93 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 123 >ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group] gi|52353395|gb|AAU43963.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group] gi|113579667|dbj|BAF18030.1| Os05g0528200 [Oryza sativa Japonica Group] gi|215693127|dbj|BAG88509.1| unnamed protein product [Oryza sativa Japonica Group] Length = 121 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 94 VNYGNFMHGLMKENIQLNRKVLAEISMHEPY 2 VNYGNFMHGLMKENIQLNRKVL+E+SMHEPY Sbjct: 63 VNYGNFMHGLMKENIQLNRKVLSELSMHEPY 93