BLASTX nr result
ID: Mentha25_contig00040438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040438 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21155.1| hypothetical protein MIMGU_mgv1a004903mg [Mimulus... 75 7e-12 gb|EXB29426.1| Protein spinster [Morus notabilis] 56 5e-06 >gb|EYU21155.1| hypothetical protein MIMGU_mgv1a004903mg [Mimulus guttatus] Length = 505 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/77 (51%), Positives = 52/77 (67%), Gaps = 1/77 (1%) Frame = -1 Query: 453 IYSFLYRTYPRDRDRARMEAIVXXXXXXXXXXXXETRGIHIQIESDERREINLDEKSIIA 274 IYSFLY TYPRDR RAR+EAIV ++RGI ++I S E E+N+D+++I Sbjct: 429 IYSFLYFTYPRDRHRARIEAIVESEMQLIKSDMLDSRGIDLRIRSSEIEELNIDDRTITE 488 Query: 273 MPFD-DNSDERTLLVTR 226 MP D D+SDERTL+ R Sbjct: 489 MPLDYDDSDERTLIPRR 505 >gb|EXB29426.1| Protein spinster [Morus notabilis] Length = 521 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 4/77 (5%) Frame = -1 Query: 453 IYSFLYRTYPRDRDRARMEAIVXXXXXXXXXXXXETRGIHIQ----IESDERREINLDEK 286 IYSFLY TYPRDR+RARM+A+V +R IH+ + ER EI+++ Sbjct: 432 IYSFLYCTYPRDRERARMDALVESEMQQLEEDNSRSREIHVSESNGLNGKERSEIDIEYG 491 Query: 285 SIIAMPFDDNSDERTLL 235 + + DDN DE+ LL Sbjct: 492 EEVGLDLDDN-DEKYLL 507