BLASTX nr result
ID: Mentha25_contig00040296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040296 (782 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35852.1| hypothetical protein MIMGU_mgv1a012470mg [Mimulus... 66 2e-08 >gb|EYU35852.1| hypothetical protein MIMGU_mgv1a012470mg [Mimulus guttatus] Length = 249 Score = 65.9 bits (159), Expect = 2e-08 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 6/90 (6%) Frame = -3 Query: 777 FGNCSDLLRHGLGQLRDPIDAMRADPFVESKS-DEQRGEMMDRIVAAEEDVETCLEDLER 601 F NCS+ LRHG G++R+ + +R +P +E+ S EQR EM I AAEED+ETC+ DL + Sbjct: 113 FKNCSNSLRHGSGRIRNALTTIRVNPLLETPSYSEQRFEMAGSIYAAEEDLETCVGDLGK 172 Query: 600 IXXXXXXXXXXXAK-----VYLNGAGDFLI 526 + K V+L GDFL+ Sbjct: 173 VEMESTAVIELRMKVLDALVHLRSRGDFLV 202