BLASTX nr result
ID: Mentha25_contig00040142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040142 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU75461.1| H2A domain containing protein [Blumeria graminis... 91 2e-16 gb|EPQ62704.1| hypothetical protein BGT96224_A21271 [Blumeria gr... 89 5e-16 >emb|CCU75461.1| H2A domain containing protein [Blumeria graminis f. sp. hordei DH14] Length = 218 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/61 (65%), Positives = 52/61 (85%) Frame = +3 Query: 3 NRKTVSINDVFSALDDSEFSMWRPRLEAELQKYNQKVGQRKEKMKHKETEGAPASKKIKR 182 NRKTV+ NDV +A+DDSEFS WRPRLE ELQKY + +GQRKEK++ KE +G+P +K++KR Sbjct: 84 NRKTVTPNDVLAAIDDSEFSDWRPRLETELQKYTEMIGQRKEKLQSKEGDGSPRAKRLKR 143 Query: 183 D 185 D Sbjct: 144 D 144 >gb|EPQ62704.1| hypothetical protein BGT96224_A21271 [Blumeria graminis f. sp. tritici 96224] Length = 286 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/61 (63%), Positives = 52/61 (85%) Frame = +3 Query: 3 NRKTVSINDVFSALDDSEFSMWRPRLEAELQKYNQKVGQRKEKMKHKETEGAPASKKIKR 182 NRKTV+ NDV +A+DDSEFS WRPRLE ELQKY + + QRKEK++ KE++G+P +K++KR Sbjct: 152 NRKTVTPNDVLAAIDDSEFSEWRPRLEIELQKYTEMISQRKEKLQSKESDGSPRAKRLKR 211 Query: 183 D 185 D Sbjct: 212 D 212