BLASTX nr result
ID: Mentha25_contig00039960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039960 (490 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELR53315.1| hypothetical protein M91_20997, partial [Bos mutus] 56 6e-06 >gb|ELR53315.1| hypothetical protein M91_20997, partial [Bos mutus] Length = 296 Score = 55.8 bits (133), Expect = 6e-06 Identities = 19/63 (30%), Positives = 38/63 (60%) Frame = -1 Query: 334 VMIYECFVCAA*VCGVREFVVLLCMRVYVFMCVCVFMLLCACVSVYVLLWVCVFLCVGEC 155 + IY C +C V +C+ +Y+++CVCV++ +C V VY+ + VC+++C+ C Sbjct: 93 IYIYVCVYIYMYICVCVYIYVCVCVYIYMYICVCVYIYICIYVCVYIYVCVCIYICIYVC 152 Query: 154 AWV 146 ++ Sbjct: 153 VYI 155