BLASTX nr result
ID: Mentha25_contig00039751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039751 (808 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltra... 64 5e-08 gb|ADO16247.1| caffeic acid O-methyltransferase [Ocimum tenuiflo... 64 5e-08 sp|Q9XGV9.1|COMT2_OCIBA RecName: Full=Caffeic acid 3-O-methyltra... 63 1e-07 sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltra... 61 4e-07 gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorr... 61 4e-07 gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorr... 61 4e-07 gb|EYU45322.1| hypothetical protein MIMGU_mgv1a009747mg [Mimulus... 57 8e-06 >sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase 1 gi|5031492|gb|AAD38189.1|AF154917_1 caffeic acid O-methyltransferase [Ocimum basilicum] Length = 361 Score = 64.3 bits (155), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEFQ LAK AGFK FNKACCAYN+WIMELLK Sbjct: 330 EKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361 >gb|ADO16247.1| caffeic acid O-methyltransferase [Ocimum tenuiflorum] Length = 361 Score = 64.3 bits (155), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEFQ LAK AGFK FNKACCAYN+WIMELLK Sbjct: 330 EKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361 >sp|Q9XGV9.1|COMT2_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 2; Short=CAOMT-2; Short=COMT-2; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase 2 gi|5031494|gb|AAD38190.1|AF154918_1 caffeic acid O-methyltransferase [Ocimum basilicum] gi|308191372|gb|ADO16248.1| caffeic acid O-methyltransferase [Ocimum basilicum] Length = 361 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEFQ LAK +GFK FNK CCAYNSWIMELLK Sbjct: 330 EKEFQVLAKASGFKQFNKVCCAYNSWIMELLK 361 >sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase gi|18025321|gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus] Length = 363 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEF+ALAKGAGF+ F K CCAYNSWIMELLK Sbjct: 332 EKEFEALAKGAGFRGFIKVCCAYNSWIMELLK 363 >gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza] Length = 364 Score = 61.2 bits (147), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEF LAK AGFKH NKACCAYN+WI+ELLK Sbjct: 333 EKEFHNLAKAAGFKHLNKACCAYNTWILELLK 364 >gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza] Length = 364 Score = 61.2 bits (147), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEF LAK AGFKH NKACCAYN+WI+ELLK Sbjct: 333 EKEFHNLAKAAGFKHLNKACCAYNTWILELLK 364 >gb|EYU45322.1| hypothetical protein MIMGU_mgv1a009747mg [Mimulus guttatus] Length = 332 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 808 EKEFQALAKGAGFKHFNKACCAYNSWIMELLK 713 EKEFQALA GAGF F+K CCA+ SWIMELLK Sbjct: 301 EKEFQALANGAGFTKFHKVCCAHGSWIMELLK 332