BLASTX nr result
ID: Mentha25_contig00039444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039444 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62600.1| hypothetical protein M569_12191, partial [Genlise... 65 1e-08 >gb|EPS62600.1| hypothetical protein M569_12191, partial [Genlisea aurea] Length = 352 Score = 65.1 bits (157), Expect = 1e-08 Identities = 45/110 (40%), Positives = 59/110 (53%), Gaps = 7/110 (6%) Frame = +3 Query: 3 FFEQQPFQILQPSSLDLFTSPSQQQSDASN------NGWATFDMPENIVPVGTDN-SXXX 161 F + P + L+ SSL LF QQQ AS+ GWATFDMP+N+V V +N + Sbjct: 110 FESKNPSKGLETSSLSLFPVEQQQQLLASDVVGPTTGGWATFDMPQNVVAVNKENIAITD 169 Query: 162 XXXXSDGMVRGNSNPFSVDQSPFSIDQSSSYQDSVGHEPSASSFTFGLES 311 + G + GN NPFSV I++SS DS +PS S FGLE+ Sbjct: 170 VPSSAGGGMMGNFNPFSV------INESSINGDSTELKPSVSVNAFGLEA 213