BLASTX nr result
ID: Mentha25_contig00039364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039364 (703 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40285.1| hypothetical protein MIMGU_mgv1a008186mg [Mimulus... 199 6e-49 ref|XP_006380676.1| hypothetical protein POPTR_0007s10370g [Popu... 180 5e-43 ref|XP_006354595.1| PREDICTED: pentatricopeptide repeat-containi... 177 4e-42 gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] 174 3e-41 ref|XP_007047423.1| Tetratricopeptide repeat (TPR)-like superfam... 173 4e-41 ref|XP_007205016.1| hypothetical protein PRUPE_ppa003703mg [Prun... 173 6e-41 emb|CBI33742.3| unnamed protein product [Vitis vinifera] 172 1e-40 ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containi... 172 1e-40 emb|CAN77232.1| hypothetical protein VITISV_001089 [Vitis vinifera] 172 1e-40 ref|XP_006466530.1| PREDICTED: pentatricopeptide repeat-containi... 171 2e-40 ref|XP_006426011.1| hypothetical protein CICLE_v10025167mg [Citr... 170 4e-40 ref|XP_004289184.1| PREDICTED: pentatricopeptide repeat-containi... 170 4e-40 ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containi... 169 6e-40 ref|XP_004229576.1| PREDICTED: pentatricopeptide repeat-containi... 169 8e-40 ref|XP_007155872.1| hypothetical protein PHAVU_003G238900g [Phas... 168 2e-39 ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containi... 165 2e-38 ref|XP_002866951.1| pentatricopeptide repeat-containing protein ... 160 3e-37 ref|XP_004509094.1| PREDICTED: pentatricopeptide repeat-containi... 159 6e-37 ref|XP_003561500.1| PREDICTED: pentatricopeptide repeat-containi... 158 1e-36 ref|NP_195454.1| pentatricopeptide repeat-containing protein [Ar... 158 2e-36 >gb|EYU40285.1| hypothetical protein MIMGU_mgv1a008186mg [Mimulus guttatus] Length = 382 Score = 199 bits (507), Expect = 6e-49 Identities = 93/112 (83%), Positives = 104/112 (92%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 K REIY+MLE++N+W++ H + SK E VLH+IEE +KERSLEVHSEKLALAF LISTKRG Sbjct: 271 KRREIYAMLEQVNQWVKEHGHTSKTEGVLHDIEESDKERSLEVHSEKLALAFGLISTKRG 330 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCV+G+CSCGDYW Sbjct: 331 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVDGLCSCGDYW 382 >ref|XP_006380676.1| hypothetical protein POPTR_0007s10370g [Populus trichocarpa] gi|550334566|gb|ERP58473.1| hypothetical protein POPTR_0007s10370g [Populus trichocarpa] Length = 631 Score = 180 bits (456), Expect = 5e-43 Identities = 83/112 (74%), Positives = 96/112 (85%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KSREIY MLEE+N WL+ H Y + + VLH++E+ +KERSL VHSEKLALAF LI+TK G Sbjct: 520 KSREIYEMLEEINGWLKTHGYTPQTDIVLHDLEDAQKERSLGVHSEKLALAFGLITTKPG 579 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCHAV KL+SKITGRK+VMRDRNRFHH V G+CSCGDYW Sbjct: 580 TTIKIVKNLRVCADCHAVTKLISKITGRKVVMRDRNRFHHFVNGLCSCGDYW 631 >ref|XP_006354595.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565376192|ref|XP_006354596.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565376194|ref|XP_006354597.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X3 [Solanum tuberosum] gi|565376199|ref|XP_006354598.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X4 [Solanum tuberosum] gi|565376201|ref|XP_006354599.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X5 [Solanum tuberosum] gi|565376203|ref|XP_006354600.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X6 [Solanum tuberosum] Length = 624 Score = 177 bits (448), Expect = 4e-42 Identities = 80/112 (71%), Positives = 98/112 (87%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY MLEEMN+WL H Y+ + E VLHN+ EVEK+++L VHSE+LA+A+ LIST+ G Sbjct: 513 KSKEIYIMLEEMNKWLEAHGYSPQIEIVLHNLGEVEKQQALAVHSERLAIAYGLISTQAG 572 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVCPDCHAV KL+SKITGRKI++RDRNRFHH V+G CSCGD+W Sbjct: 573 TTIKIVKNLRVCPDCHAVTKLISKITGRKIIVRDRNRFHHFVDGSCSCGDFW 624 >gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] Length = 625 Score = 174 bits (440), Expect = 3e-41 Identities = 79/112 (70%), Positives = 96/112 (85%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS++IY MLEE+N+WL+ + Y + + VLH++ E +KE+SLEVHSEKLA+AF LISTK G Sbjct: 514 KSKQIYKMLEEINDWLKANGYTPQTDIVLHDLGERQKEQSLEVHSEKLAIAFGLISTKPG 573 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TI++VKNLRVCPDCHAV KL+SKITGRKIVMRDRNRFHH G CSCGDYW Sbjct: 574 TTIRVVKNLRVCPDCHAVTKLISKITGRKIVMRDRNRFHHFENGSCSCGDYW 625 >ref|XP_007047423.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699684|gb|EOX91580.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 633 Score = 173 bits (439), Expect = 4e-41 Identities = 81/112 (72%), Positives = 94/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY+MLEEMN WL+ H Y + + VLH+I +V+KE+SLEVHSEKLALA+ LI T+ G Sbjct: 522 KSKEIYTMLEEMNGWLKAHGYTPQTDIVLHDIGDVQKEQSLEVHSEKLALAYGLICTQPG 581 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 + IKIVKNLRVC DCHA KL+SKITGRKIVMRDRNRFHH V G CSCGDYW Sbjct: 582 TPIKIVKNLRVCSDCHAATKLISKITGRKIVMRDRNRFHHFVNGSCSCGDYW 633 >ref|XP_007205016.1| hypothetical protein PRUPE_ppa003703mg [Prunus persica] gi|462400658|gb|EMJ06215.1| hypothetical protein PRUPE_ppa003703mg [Prunus persica] Length = 555 Score = 173 bits (438), Expect = 6e-41 Identities = 80/112 (71%), Positives = 94/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 +S+EIY M++EMN+WL H Y + + VLH++ E EKE+SLEVHSEKLA+AF LIST+ G Sbjct: 444 RSKEIYMMIKEMNQWLTAHGYTPQIDTVLHDLGEREKEQSLEVHSEKLAIAFGLISTQPG 503 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCHAV KL+SKITGRKIVMRDRNRFHH G CSCGDYW Sbjct: 504 TTIKIVKNLRVCSDCHAVTKLISKITGRKIVMRDRNRFHHFANGSCSCGDYW 555 >emb|CBI33742.3| unnamed protein product [Vitis vinifera] Length = 562 Score = 172 bits (436), Expect = 1e-40 Identities = 81/112 (72%), Positives = 93/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 K +EIY MLEE+N WL+ H Y + + VLH+I E EKERSLEVHSEKLA+AF LI+T+ G Sbjct: 451 KRKEIYMMLEEINGWLKSHGYTPQTDIVLHDIGETEKERSLEVHSEKLAIAFGLINTQPG 510 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCH V KL+SKITGRKIV+RDRNRFHH V G CSCGDYW Sbjct: 511 TTIKIVKNLRVCADCHEVTKLISKITGRKIVVRDRNRFHHFVNGSCSCGDYW 562 >ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Vitis vinifera] Length = 628 Score = 172 bits (436), Expect = 1e-40 Identities = 81/112 (72%), Positives = 93/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 K +EIY MLEE+N WL+ H Y + + VLH+I E EKERSLEVHSEKLA+AF LI+T+ G Sbjct: 517 KRKEIYMMLEEINGWLKSHGYTPQTDIVLHDIGETEKERSLEVHSEKLAIAFGLINTQPG 576 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCH V KL+SKITGRKIV+RDRNRFHH V G CSCGDYW Sbjct: 577 TTIKIVKNLRVCADCHEVTKLISKITGRKIVVRDRNRFHHFVNGSCSCGDYW 628 >emb|CAN77232.1| hypothetical protein VITISV_001089 [Vitis vinifera] Length = 575 Score = 172 bits (436), Expect = 1e-40 Identities = 81/112 (72%), Positives = 93/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 K +EIY MLEE+N WL+ H Y + + VLH+I E EKERSLEVHSEKLA+AF LI+T+ G Sbjct: 464 KRKEIYMMLEEINGWLKSHGYTPQTDIVLHDIGETEKERSLEVHSEKLAIAFGLINTQPG 523 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCH V KL+SKITGRKIV+RDRNRFHH V G CSCGDYW Sbjct: 524 TTIKIVKNLRVCADCHEVTKLISKITGRKIVVRDRNRFHHFVNGSCSCGDYW 575 >ref|XP_006466530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Citrus sinensis] Length = 622 Score = 171 bits (433), Expect = 2e-40 Identities = 79/112 (70%), Positives = 93/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY MLEE+N WL+ Y + + VLH+I E +K+ SLEVHSEKLA+AF LIST+ G Sbjct: 511 KSKEIYMMLEEINGWLKAEGYVPQTQIVLHDIGEKQKQNSLEVHSEKLAVAFGLISTQPG 570 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 ++IKIVKNLRVCPDCHAV KL+SK TGRKI+MRDRNRFHH V G CSCGDYW Sbjct: 571 TSIKIVKNLRVCPDCHAVFKLISKFTGRKIMMRDRNRFHHFVNGTCSCGDYW 622 >ref|XP_006426011.1| hypothetical protein CICLE_v10025167mg [Citrus clementina] gi|557528001|gb|ESR39251.1| hypothetical protein CICLE_v10025167mg [Citrus clementina] Length = 622 Score = 170 bits (431), Expect = 4e-40 Identities = 79/112 (70%), Positives = 93/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY MLEE+N WL+ Y + + VLH+I E +K+ SLEVHSEKLA+AF LIST+ G Sbjct: 511 KSKEIYMMLEEINGWLKAEGYILQTQIVLHDIGEKQKQNSLEVHSEKLAVAFGLISTQPG 570 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 ++IKIVKNLRVCPDCHAV KL+SK TGRKI+MRDRNRFHH V G CSCGDYW Sbjct: 571 TSIKIVKNLRVCPDCHAVFKLISKFTGRKIMMRDRNRFHHFVNGTCSCGDYW 622 >ref|XP_004289184.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 619 Score = 170 bits (431), Expect = 4e-40 Identities = 78/112 (69%), Positives = 94/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 +S E+Y+M+EE+N+WL+ Y + E VLH++ E EK +SLEVHSEKLA+AF LIST+ G Sbjct: 508 RSSEVYTMIEEINQWLKADGYTPQTETVLHDLGEREKAQSLEVHSEKLAIAFGLISTQPG 567 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +T+KIVKNLRVC DCHAV KL+SKITGRKIVMRDRNRFHH V G CSCGDYW Sbjct: 568 TTLKIVKNLRVCSDCHAVTKLISKITGRKIVMRDRNRFHHFVNGSCSCGDYW 619 >ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] gi|449513125|ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] Length = 645 Score = 169 bits (429), Expect = 6e-40 Identities = 76/112 (67%), Positives = 94/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY ML E+N WL+ Y + + VLH++ E +KE+SLEVHSEKLA+AF LISTK G Sbjct: 534 KSKEIYVMLNEINSWLKARGYTPQTDVVLHDLREEQKEQSLEVHSEKLAIAFGLISTKPG 593 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +T+KIVKNLRVC DCH V+K++S+ITGRKIVMRDRNRFHH +G+CSCGDYW Sbjct: 594 TTVKIVKNLRVCSDCHTVMKMISEITGRKIVMRDRNRFHHFEDGLCSCGDYW 645 >ref|XP_004229576.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Solanum lycopersicum] Length = 624 Score = 169 bits (428), Expect = 8e-40 Identities = 77/112 (68%), Positives = 96/112 (85%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY MLEE+N+ L H Y + + VLHN+ EVEK+++L VHSE+LA+A+ LIST+ G Sbjct: 513 KSKEIYIMLEEVNKLLEAHGYLPQTDIVLHNLGEVEKQQALAVHSERLAIAYGLISTQAG 572 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVCPDCHAV KL+SKITGRKI++RDRNRFHH V+G CSCGD+W Sbjct: 573 TTIKIVKNLRVCPDCHAVTKLISKITGRKIIVRDRNRFHHFVDGSCSCGDFW 624 >ref|XP_007155872.1| hypothetical protein PHAVU_003G238900g [Phaseolus vulgaris] gi|561029226|gb|ESW27866.1| hypothetical protein PHAVU_003G238900g [Phaseolus vulgaris] Length = 625 Score = 168 bits (425), Expect = 2e-39 Identities = 78/112 (69%), Positives = 94/112 (83%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 +S++IYSMLEEMN WL+ Y K + VLH+I E +KE+SLEVHSEKLALAF L+ST G Sbjct: 514 RSKDIYSMLEEMNCWLKARGYTPKIDVVLHDIGEQQKEQSLEVHSEKLALAFGLLSTSPG 573 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKI+KNLRVC DCHAV+K++SKI+GRKI+MRDRNRFHH G CSCGDYW Sbjct: 574 TTIKIIKNLRVCLDCHAVMKMMSKISGRKIIMRDRNRFHHFENGSCSCGDYW 625 >ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Glycine max] Length = 628 Score = 165 bits (417), Expect = 2e-38 Identities = 78/112 (69%), Positives = 92/112 (82%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 +S++IYSMLE+MN WL+ Y K + VLH+I E EKE+SLEVHSEKLALAF LIST G Sbjct: 517 RSKDIYSMLEKMNGWLKERHYTPKTDAVLHDIGEQEKEQSLEVHSEKLALAFGLISTSPG 576 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 + IKIVKNLRVC DCHAV+K++SKI+GRKI+MRDRNRFHH G CSC DYW Sbjct: 577 AAIKIVKNLRVCLDCHAVMKIMSKISGRKIIMRDRNRFHHFENGSCSCRDYW 628 >ref|XP_002866951.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312787|gb|EFH43210.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 630 Score = 160 bits (406), Expect = 3e-37 Identities = 74/112 (66%), Positives = 90/112 (80%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY+ML +M+E ++ H Y VLH++EE EKERSL+VHSE+LA+A+ LISTK G Sbjct: 519 KSKEIYTMLRKMSERIKSHGYVPNTNTVLHDLEETEKERSLQVHSERLAIAYGLISTKPG 578 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 S +KI KNLRVC DCH V KL+SKITGRKIVMRDRNRFHH +G CSC D+W Sbjct: 579 SPLKIFKNLRVCSDCHTVTKLISKITGRKIVMRDRNRFHHFSDGSCSCDDFW 630 >ref|XP_004509094.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cicer arietinum] Length = 632 Score = 159 bits (403), Expect = 6e-37 Identities = 77/112 (68%), Positives = 92/112 (82%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS++IY MLEEMN WL+ + Y+ K + VL +I E +KE SLEVHSEKLALAF LIST+ G Sbjct: 521 KSKDIYFMLEEMNGWLKGNGYSPKTDVVLLDIGEEQKELSLEVHSEKLALAFGLISTRPG 580 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLRVC DCH V+K++S ITGRKIVMRD+NRFHH G CSCGD+W Sbjct: 581 TTIKIVKNLRVCLDCHTVMKMISTITGRKIVMRDQNRFHHFDTGSCSCGDFW 632 >ref|XP_003561500.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Brachypodium distachyon] Length = 892 Score = 158 bits (400), Expect = 1e-36 Identities = 73/112 (65%), Positives = 92/112 (82%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 ++ EIY ML++MN ++ H + + E VLH+++E KE++L VHSEKLALAF LIST+ G Sbjct: 781 RTDEIYVMLDKMNGLVKEHGHVPQTELVLHDLDEATKEKALAVHSEKLALAFGLISTQPG 840 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 +TIKIVKNLR C DCHAV+KL+S+ITGRKIV RDRNRFHH V+G CSCGDYW Sbjct: 841 ATIKIVKNLRACSDCHAVLKLISRITGRKIVFRDRNRFHHFVDGSCSCGDYW 892 >ref|NP_195454.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213666|sp|Q9SZT8.1|PP354_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g37380, chloroplastic; Flags: Precursor gi|4468804|emb|CAB38205.1| putative protein [Arabidopsis thaliana] gi|7270720|emb|CAB80403.1| putative protein [Arabidopsis thaliana] gi|332661386|gb|AEE86786.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 632 Score = 158 bits (399), Expect = 2e-36 Identities = 72/112 (64%), Positives = 90/112 (80%) Frame = -2 Query: 702 KSREIYSMLEEMNEWLRVHDYASKKEEVLHNIEEVEKERSLEVHSEKLALAFALISTKRG 523 KS+EIY+ML +++E ++ H Y VL ++EE EKE+SL+VHSE+LA+A+ LISTK G Sbjct: 521 KSKEIYTMLRKISERIKSHGYVPNTNTVLQDLEETEKEQSLQVHSERLAIAYGLISTKPG 580 Query: 522 STIKIVKNLRVCPDCHAVIKLVSKITGRKIVMRDRNRFHHCVEGVCSCGDYW 367 S +KI KNLRVC DCH V KL+SKITGRKIVMRDRNRFHH +G CSCGD+W Sbjct: 581 SPLKIFKNLRVCSDCHTVTKLISKITGRKIVMRDRNRFHHFTDGSCSCGDFW 632