BLASTX nr result
ID: Mentha25_contig00039155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039155 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846572.1| hypothetical protein AMTR_s00018p00244280 [A... 58 2e-06 ref|XP_006360645.1| PREDICTED: CBL-interacting serine/threonine-... 56 6e-06 ref|XP_004240116.1| PREDICTED: CBL-interacting serine/threonine-... 56 6e-06 emb|CBI38698.3| unnamed protein product [Vitis vinifera] 56 6e-06 >ref|XP_006846572.1| hypothetical protein AMTR_s00018p00244280 [Amborella trichopoda] gi|548849382|gb|ERN08247.1| hypothetical protein AMTR_s00018p00244280 [Amborella trichopoda] Length = 446 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 DTLEFHKFYKNFSSGLKDIVWTSEANDDQT 91 DTLEFHKFYK+FSSGLKDIVW SEAN ++T Sbjct: 410 DTLEFHKFYKSFSSGLKDIVWKSEANTEET 439 >ref|XP_006360645.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 9-like [Solanum tuberosum] Length = 451 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 2 DTLEFHKFYKNFSSGLKDIVWTSEANDDQ 88 DTLEFHKFYKNFSSGLKDIVWT+E +Q Sbjct: 416 DTLEFHKFYKNFSSGLKDIVWTTEQTTEQ 444 >ref|XP_004240116.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 9-like [Solanum lycopersicum] Length = 451 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 2 DTLEFHKFYKNFSSGLKDIVWTSEANDDQ 88 DTLEFHKFYKNFSSGLKDIVWT+E +Q Sbjct: 416 DTLEFHKFYKNFSSGLKDIVWTTEQTTEQ 444 >emb|CBI38698.3| unnamed protein product [Vitis vinifera] Length = 440 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 DTLEFHKFYKNFSSGLKDIVWTSEANDDQ 88 DTLEFHKFYK+FSSGLKDIVW SEAN ++ Sbjct: 409 DTLEFHKFYKSFSSGLKDIVWKSEANTEE 437