BLASTX nr result
ID: Mentha25_contig00039027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039027 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24084.1| hypothetical protein MIMGU_mgv1a009982mg [Mimulus... 64 3e-08 >gb|EYU24084.1| hypothetical protein MIMGU_mgv1a009982mg [Mimulus guttatus] Length = 325 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/74 (50%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = +2 Query: 107 MEC---AFMNGFGCGPEMLKTAAFADEFLVVNGSSHGVSGDDLFVDELLDFSNDFEEGAE 277 MEC A + GF TAAF ++FL NG + VSGDDLFVDELLDFSNDF E E Sbjct: 1 MECVQGALVGGFEPETVFKSTAAFMEDFLGSNGVPNAVSGDDLFVDELLDFSNDFSE--E 58 Query: 278 QQPQQLDKPEGKEQ 319 ++ ++ +KP E+ Sbjct: 59 EEIEEDEKPLQPEE 72