BLASTX nr result
ID: Mentha25_contig00038999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00038999 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29068.1| hypothetical protein MIMGU_mgv1a008043mg [Mimulus... 69 7e-10 ref|XP_006355705.1| PREDICTED: 26S proteasome non-ATPase regulat... 69 7e-10 gb|EPS66042.1| hypothetical protein M569_08736, partial [Genlise... 69 7e-10 ref|XP_004239900.1| PREDICTED: 26S proteasome non-ATPase regulat... 69 7e-10 ref|XP_003631488.1| PREDICTED: 26S proteasome non-ATPase regulat... 68 2e-09 emb|CBI33798.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulat... 68 2e-09 ref|XP_006368029.1| PREDICTED: 26S proteasome non-ATPase regulat... 67 3e-09 ref|XP_004247773.1| PREDICTED: 26S proteasome non-ATPase regulat... 67 3e-09 ref|XP_002304360.1| 26S proteasome regulatory subunit family pro... 67 3e-09 ref|XP_006368338.1| 26S proteasome regulatory subunit family pro... 67 3e-09 ref|XP_006854063.1| hypothetical protein AMTR_s00048p00097960 [A... 65 1e-08 ref|XP_006281534.1| hypothetical protein CARUB_v10027635mg [Caps... 65 1e-08 gb|EXC26225.1| 26S proteasome non-ATPase regulatory subunit 13 [... 64 2e-08 ref|XP_006414023.1| hypothetical protein EUTSA_v10025439mg [Eutr... 64 2e-08 ref|XP_006398242.1| hypothetical protein EUTSA_v10000920mg [Eutr... 64 2e-08 ref|XP_007209236.1| hypothetical protein PRUPE_ppa007016mg [Prun... 64 2e-08 ref|NP_680721.2| proteasome component (PCI) domain-containing pr... 64 2e-08 ref|XP_004146109.1| PREDICTED: 26S proteasome non-ATPase regulat... 64 3e-08 gb|ABB18115.1| RPN9 [Nicotiana benthamiana] 64 3e-08 >gb|EYU29068.1| hypothetical protein MIMGU_mgv1a008043mg [Mimulus guttatus] Length = 386 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVAA Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 386 >ref|XP_006355705.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Solanum tuberosum] Length = 386 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVAA Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 386 >gb|EPS66042.1| hypothetical protein M569_08736, partial [Genlisea aurea] Length = 385 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVAA Sbjct: 352 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 385 >ref|XP_004239900.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Solanum lycopersicum] Length = 386 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVAA Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 386 >ref|XP_003631488.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like isoform 2 [Vitis vinifera] Length = 400 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVA+ Sbjct: 367 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 400 >emb|CBI33798.3| unnamed protein product [Vitis vinifera] Length = 181 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVA+ Sbjct: 148 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 181 >ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like isoform 1 [Vitis vinifera] Length = 386 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLVA+ Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 386 >ref|XP_006368029.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Solanum tuberosum] Length = 386 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLV++ Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVSS 386 >ref|XP_004247773.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Solanum lycopersicum] Length = 386 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWVDKVHTALLSVEAETPDLV++ Sbjct: 353 PQIKSLRDRLDNWVDKVHTALLSVEAETPDLVSS 386 >ref|XP_002304360.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] gi|222841792|gb|EEE79339.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] Length = 386 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNW+DKVHTALLSVEAETPDLVA+ Sbjct: 353 PQIKSLRDRLDNWLDKVHTALLSVEAETPDLVAS 386 >ref|XP_006368338.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] gi|550346244|gb|ERP64907.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] Length = 386 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNW+DKVHTALLSVEAETPDLVA+ Sbjct: 353 PQIKSLRDRLDNWLDKVHTALLSVEAETPDLVAS 386 >ref|XP_006854063.1| hypothetical protein AMTR_s00048p00097960 [Amborella trichopoda] gi|548857732|gb|ERN15530.1| hypothetical protein AMTR_s00048p00097960 [Amborella trichopoda] Length = 384 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLD+W+DKVHTALLSVEAETPDLVA+ Sbjct: 351 PQIKSLRDRLDSWLDKVHTALLSVEAETPDLVAS 384 >ref|XP_006281534.1| hypothetical protein CARUB_v10027635mg [Capsella rubella] gi|482550238|gb|EOA14432.1| hypothetical protein CARUB_v10027635mg [Capsella rubella] Length = 386 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIK+LR++LDNWVDKVHT LLSVEAETPDLVAA Sbjct: 353 PQIKALRDQLDNWVDKVHTTLLSVEAETPDLVAA 386 >gb|EXC26225.1| 26S proteasome non-ATPase regulatory subunit 13 [Morus notabilis] Length = 387 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLD W+DKVHTALLS+EAETPDLVA+ Sbjct: 354 PQIKSLRDRLDTWLDKVHTALLSIEAETPDLVAS 387 >ref|XP_006414023.1| hypothetical protein EUTSA_v10025439mg [Eutrema salsugineum] gi|557115193|gb|ESQ55476.1| hypothetical protein EUTSA_v10025439mg [Eutrema salsugineum] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR++LD+WVDKVHT LLSVEAETPDLVAA Sbjct: 353 PQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVAA 386 >ref|XP_006398242.1| hypothetical protein EUTSA_v10000920mg [Eutrema salsugineum] gi|557099331|gb|ESQ39695.1| hypothetical protein EUTSA_v10000920mg [Eutrema salsugineum] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR++LD+WVDKVHT LLSVEAETPDLVAA Sbjct: 353 PQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVAA 386 >ref|XP_007209236.1| hypothetical protein PRUPE_ppa007016mg [Prunus persica] gi|462404971|gb|EMJ10435.1| hypothetical protein PRUPE_ppa007016mg [Prunus persica] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLD W+DKVHTALLS+EAETPDLVA+ Sbjct: 353 PQIKSLRDRLDGWLDKVHTALLSIEAETPDLVAS 386 >ref|NP_680721.2| proteasome component (PCI) domain-containing protein [Arabidopsis thaliana] gi|75244426|sp|Q8GYA6.1|PS13B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 13 homolog B; AltName: Full=26S proteasome regulatory subunit RPN9b; Short=AtRNP9b; AltName: Full=26S proteasome regulatory subunit S11 homolog B gi|26450594|dbj|BAC42409.1| unknown protein [Arabidopsis thaliana] gi|32700038|gb|AAP86669.1| 26S proteasome subunit RPN9b [Arabidopsis thaliana] gi|332658724|gb|AEE84124.1| proteasome component (PCI) domain-containing protein [Arabidopsis thaliana] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR++LD+WVDKVHT LLSVEAETPDLVAA Sbjct: 353 PQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVAA 386 >ref|XP_004146109.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Cucumis sativus] gi|449509507|ref|XP_004163608.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Cucumis sativus] Length = 386 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 300 QIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 QIKSLR+RLDNWV+KVHTALLSVEAETPDLVA+ Sbjct: 354 QIKSLRDRLDNWVEKVHTALLSVEAETPDLVAS 386 >gb|ABB18115.1| RPN9 [Nicotiana benthamiana] Length = 359 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 303 PQIKSLRNRLDNWVDKVHTALLSVEAETPDLVAA 202 PQIKSLR+RLDNWV+KVHT LL+VEAETPDLVA+ Sbjct: 326 PQIKSLRDRLDNWVEKVHTTLLAVEAETPDLVAS 359