BLASTX nr result
ID: Mentha25_contig00038845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00038845 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18131.1| hypothetical protein MIMGU_mgv1a025649mg [Mimulus... 72 1e-10 gb|EXC01923.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] 66 6e-09 ref|XP_003518193.2| PREDICTED: aspartic proteinase nepenthesin-2... 66 6e-09 ref|XP_007145803.1| hypothetical protein PHAVU_007G269300g [Phas... 65 1e-08 ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2... 64 2e-08 emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] 64 2e-08 ref|XP_006589861.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 6e-08 emb|CBI28265.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002280866.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 1e-07 ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phas... 61 1e-07 ref|XP_003553619.1| PREDICTED: aspartic proteinase nepenthesin-2... 61 1e-07 ref|XP_004303503.1| PREDICTED: aspartic proteinase nepenthesin-2... 61 2e-07 ref|XP_003520712.1| PREDICTED: aspartic proteinase nepenthesin-2... 60 2e-07 ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223... 60 2e-07 ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1... 60 3e-07 emb|CAN67405.1| hypothetical protein VITISV_025616 [Vitis vinifera] 60 4e-07 ref|XP_006424129.1| hypothetical protein CICLE_v10028374mg [Citr... 59 7e-07 emb|CAE03456.1| OSJNBa0088H09.14 [Oryza sativa Japonica Group] 59 9e-07 gb|EEE61941.1| hypothetical protein OsJ_16693 [Oryza sativa Japo... 59 9e-07 ref|NP_001054316.1| Os04g0685200 [Oryza sativa Japonica Group] g... 59 9e-07 >gb|EYU18131.1| hypothetical protein MIMGU_mgv1a025649mg [Mimulus guttatus] Length = 462 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 54 PGPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 PGPAIILGNYQQQNFYMEYDLENERLGF+ Q+CK Sbjct: 429 PGPAIILGNYQQQNFYMEYDLENERLGFKRQLCK 462 >gb|EXC01923.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] Length = 473 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 3 ICMTXXXXXXXXXXXXXPGPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 +C+T GPAIILGNYQQQNF++EYDL+NER GFR Q+CK Sbjct: 423 VCLTVVTNDDVGGPESVGGPAIILGNYQQQNFHIEYDLKNERFGFRRQICK 473 >ref|XP_003518193.2| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 478 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPA+ILGNYQQQNFY+EYDLENER GFRSQ C+ Sbjct: 443 GPAVILGNYQQQNFYVEYDLENERFGFRSQSCQ 475 >ref|XP_007145803.1| hypothetical protein PHAVU_007G269300g [Phaseolus vulgaris] gi|561018993|gb|ESW17797.1| hypothetical protein PHAVU_007G269300g [Phaseolus vulgaris] Length = 458 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPA+ILGNYQQQNFY+EYDL NER GFRSQ CK Sbjct: 423 GPAVILGNYQQQNFYVEYDLGNERFGFRSQSCK 455 >ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 467 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGN+QQQNFY+EYDL NERLGFR Q CK Sbjct: 435 GPAIILGNFQQQNFYVEYDLRNERLGFRQQSCK 467 >emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] Length = 454 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGN+QQQNFY+EYDL NERLGFR Q CK Sbjct: 422 GPAIILGNFQQQNFYVEYDLRNERLGFRQQSCK 454 >ref|XP_006589861.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 485 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPA+ILGNYQQQNFY+E DLENER GFRSQ C+ Sbjct: 449 GPAVILGNYQQQNFYVECDLENERFGFRSQSCQ 481 >emb|CBI28265.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GPAIILGN+QQQNFY+EYDL NERLGFR Q C Sbjct: 354 GPAIILGNFQQQNFYVEYDLRNERLGFRQQSC 385 >ref|XP_002280866.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 469 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GP+IILGNYQ QNFY EYDLENER GFR Q CK Sbjct: 437 GPSIILGNYQSQNFYTEYDLENERFGFRRQRCK 469 >ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] gi|561036422|gb|ESW34952.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] Length = 466 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGNYQQQNF++EYDLENER GF Q CK Sbjct: 431 GPAIILGNYQQQNFHIEYDLENERFGFGPQSCK 463 >ref|XP_003553619.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 470 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGNYQQQNFY+EYDLENER GF + CK Sbjct: 435 GPAIILGNYQQQNFYVEYDLENERFGFGPRNCK 467 >ref|XP_004303503.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Fragaria vesca subsp. vesca] Length = 458 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPA+ILGN+QQQNFY+EYDLE ER GF+ Q CK Sbjct: 425 GPAVILGNFQQQNFYVEYDLERERFGFKKQSCK 457 >ref|XP_003520712.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 474 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGNYQQQNFY+EYDLENER GF + C+ Sbjct: 439 GPAIILGNYQQQNFYIEYDLENERFGFGPRSCR 471 >ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223525662|gb|EEF28148.1| pepsin A, putative [Ricinus communis] Length = 468 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GPAIILGN+QQQNFY+EYDLEN+R GF+ Q C Sbjct: 436 GPAIILGNFQQQNFYIEYDLENDRFGFKEQSC 467 >ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Citrus sinensis] Length = 465 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GPAIILGN+Q QN+Y+EYDL N+RLGF+ Q+CK Sbjct: 433 GPAIILGNFQMQNYYVEYDLRNQRLGFKQQLCK 465 >emb|CAN67405.1| hypothetical protein VITISV_025616 [Vitis vinifera] Length = 609 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GP+IILGNYQ QNFY EYDLENER GFR Q C Sbjct: 437 GPSIILGNYQSQNFYTEYDLENERFGFRRQRC 468 >ref|XP_006424129.1| hypothetical protein CICLE_v10028374mg [Citrus clementina] gi|557526063|gb|ESR37369.1| hypothetical protein CICLE_v10028374mg [Citrus clementina] Length = 467 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVCK 155 GP+IILGN+Q QN+Y+EYDL N+RLGF+ Q+CK Sbjct: 435 GPSIILGNFQMQNYYVEYDLRNQRLGFKQQLCK 467 >emb|CAE03456.1| OSJNBa0088H09.14 [Oryza sativa Japonica Group] Length = 490 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GPAIILG++QQQN+Y+EYDLE ERLGFR Q C Sbjct: 455 GPAIILGSFQQQNYYIEYDLEKERLGFRRQQC 486 >gb|EEE61941.1| hypothetical protein OsJ_16693 [Oryza sativa Japonica Group] Length = 648 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GPAIILG++QQQN+Y+EYDLE ERLGFR Q C Sbjct: 456 GPAIILGSFQQQNYYIEYDLEKERLGFRRQQC 487 >ref|NP_001054316.1| Os04g0685200 [Oryza sativa Japonica Group] gi|113565887|dbj|BAF16230.1| Os04g0685200, partial [Oryza sativa Japonica Group] Length = 330 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 57 GPAIILGNYQQQNFYMEYDLENERLGFRSQVC 152 GPAIILG++QQQN+Y+EYDLE ERLGFR Q C Sbjct: 295 GPAIILGSFQQQNYYIEYDLEKERLGFRRQQC 326