BLASTX nr result
ID: Mentha25_contig00038568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00038568 (1028 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF17086.1| hypothetical protein SEPMUDRAFT_57142 [Sphaerulin... 59 3e-06 ref|XP_001797295.1| hypothetical protein SNOG_06934 [Phaeosphaer... 58 6e-06 gb|EME88257.1| hypothetical protein MYCFIDRAFT_55264 [Pseudocerc... 57 9e-06 >gb|EMF17086.1| hypothetical protein SEPMUDRAFT_57142 [Sphaerulina musiva SO2202] Length = 353 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 GGMPDLSSLMQDPNIADMANKFLGGAGRGAG 93 GGMPDLSSLM DPNIAD+A F+GGAGRGAG Sbjct: 320 GGMPDLSSLMNDPNIADLARNFMGGAGRGAG 350 >ref|XP_001797295.1| hypothetical protein SNOG_06934 [Phaeosphaeria nodorum SN15] gi|160701484|gb|EAT85585.2| hypothetical protein SNOG_06934 [Phaeosphaeria nodorum SN15] Length = 372 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 GGMPDLSSLMQDPNIADMANKFLGGAGRGAG 93 GGMPD++SLM DPNIADMA F+GGAGRGAG Sbjct: 337 GGMPDIASLMNDPNIADMARNFMGGAGRGAG 367 >gb|EME88257.1| hypothetical protein MYCFIDRAFT_55264 [Pseudocercospora fijiensis CIRAD86] Length = 363 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GGMPDLSSLMQDPNIADMANKFLGGAGRGAG 93 GGMPDLS+LM DPNIA+MA +F+GGAGRGAG Sbjct: 330 GGMPDLSALMNDPNIANMARQFMGGAGRGAG 360