BLASTX nr result
ID: Mentha25_contig00038225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00038225 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETV88288.1| hypothetical protein H257_01580, partial [Aphanom... 41 2e-06 >gb|ETV88288.1| hypothetical protein H257_01580, partial [Aphanomyces astaci] Length = 278 Score = 40.8 bits (94), Expect(2) = 2e-06 Identities = 18/61 (29%), Positives = 34/61 (55%) Frame = +2 Query: 104 EILKMKGGNNYKQQHMKKNALLSQRNLPSNLEVPIHLVRESIEYLIGEDFTEGIEDLIAD 283 E++++ G NNYK HMKK +L + LP + + ++ + L D + ++DL A+ Sbjct: 179 EVIRVAGNNNYKIPHMKKASLALKGMLPEVVAADVDVLNDGFALLRATDMAKKVDDLSAE 238 Query: 284 L 286 + Sbjct: 239 V 239 Score = 36.2 bits (82), Expect(2) = 2e-06 Identities = 14/32 (43%), Positives = 24/32 (75%) Frame = +1 Query: 1 SKNADELIAAVRTSFNAIDPMSLNKVFLSLQC 96 S+N D+++AA ++ ++PM+LN FL+LQC Sbjct: 144 SRNVDDIVAASDEAWKQVEPMTLNANFLTLQC 175