BLASTX nr result
ID: Mentha25_contig00038068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00038068 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363138.1| PREDICTED: anthocyanidin 3-O-glucosyltransfe... 58 2e-06 >ref|XP_006363138.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Solanum tuberosum] Length = 493 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 1 RTLMEGEDGKSLREKVKQLKMSGNEALKVGGSSHNSMCEVLAKI 132 R +M+ +DGK L+E VK+LKMS +AL VGGSSH+SMC+VL I Sbjct: 437 RMVMQYKDGKELKENVKKLKMSAEKALSVGGSSHDSMCQVLKDI 480