BLASTX nr result
ID: Mentha25_contig00037885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00037885 (639 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45723.1| hypothetical protein MIMGU_mgv1a007685mg [Mimulus... 59 1e-06 >gb|EYU45723.1| hypothetical protein MIMGU_mgv1a007685mg [Mimulus guttatus] Length = 398 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 3/67 (4%) Frame = -1 Query: 639 NEKLVFVKPIDHEDFHVALVRAKILP-SIPVR-ELQQDLPSSGRVVENHT-HISSRIL*S 469 NE LVF KP+DHE+FH ALVRA P + P++ E Q++L S RV E+H + + L S Sbjct: 331 NEGLVFAKPLDHEEFHAALVRANTPPHTFPIQEESQRELLCSPRVAEHHNCNGQPKTLSS 390 Query: 468 NACEEAI 448 NACEE I Sbjct: 391 NACEETI 397