BLASTX nr result
ID: Mentha25_contig00037715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00037715 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38820.1| hypothetical protein MIMGU_mgv1a011279mg [Mimulus... 75 7e-12 ref|XP_004249251.1| PREDICTED: transmembrane protein 19-like [So... 67 2e-09 ref|XP_006351300.1| PREDICTED: transmembrane protein 19-like [So... 67 3e-09 ref|XP_002284876.1| PREDICTED: transmembrane protein 19 [Vitis v... 67 3e-09 ref|XP_007202527.1| hypothetical protein PRUPE_ppa010966mg [Prun... 65 8e-09 ref|XP_002515562.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_007013286.1| Integral membrane protein-like isoform 3 [Th... 63 4e-08 ref|XP_007013284.1| Integral membrane protein-like isoform 1 [Th... 63 4e-08 gb|EXB76245.1| Transmembrane protein 19 [Morus notabilis] 62 6e-08 ref|XP_004149856.1| PREDICTED: transmembrane protein 19-like [Cu... 60 2e-07 ref|XP_004287388.1| PREDICTED: transmembrane protein 19-like [Fr... 60 3e-07 ref|XP_002324403.2| hypothetical protein POPTR_0018s06340g [Popu... 57 2e-06 >gb|EYU38820.1| hypothetical protein MIMGU_mgv1a011279mg [Mimulus guttatus] Length = 287 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 ME NLVQP +AA +SAAI+ RSYRKKSLD SGA +GFAV+TIH AVNYR Sbjct: 1 MENNLVQPLIAAIISAAIAARSYRKKSLDFSGAISGFAVMTIHIAVNYR 49 >ref|XP_004249251.1| PREDICTED: transmembrane protein 19-like [Solanum lycopersicum] Length = 287 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 MEK+L+QP VAA LS+ I+FRSY++KSL+LSGA AG V+ IH AVNYR Sbjct: 1 MEKHLIQPAVAAVLSSVIAFRSYKRKSLNLSGAIAGVIVMFIHLAVNYR 49 >ref|XP_006351300.1| PREDICTED: transmembrane protein 19-like [Solanum tuberosum] Length = 287 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 MEK+L+QP VAA LS+ I+FRSY++KSL LSGA AG V+ IH AVNYR Sbjct: 1 MEKHLIQPAVAALLSSVIAFRSYKRKSLSLSGAIAGVIVMFIHLAVNYR 49 >ref|XP_002284876.1| PREDICTED: transmembrane protein 19 [Vitis vinifera] gi|297738884|emb|CBI28129.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 ME +QP +A SAAI+ RS+R+KSLDLSGAFAGFAVLTIH V YR Sbjct: 1 MENFPIQPIIAILFSAAIAIRSFRRKSLDLSGAFAGFAVLTIHFGVGYR 49 >ref|XP_007202527.1| hypothetical protein PRUPE_ppa010966mg [Prunus persica] gi|462398058|gb|EMJ03726.1| hypothetical protein PRUPE_ppa010966mg [Prunus persica] Length = 228 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = +2 Query: 176 DMEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 +M+K L+QP +A +S+ I+ R+YR+KSLDLSGA AGFAV+TIH A+ YR Sbjct: 6 NMDKLLIQPLIALLISSLIAARAYRRKSLDLSGAIAGFAVMTIHIAIGYR 55 >ref|XP_002515562.1| conserved hypothetical protein [Ricinus communis] gi|223545506|gb|EEF47011.1| conserved hypothetical protein [Ricinus communis] Length = 271 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 ME N++QP + A +S+ I+ R+Y++KSL+LSGA AGF V+TIH AV+YR Sbjct: 1 MEGNIIQPLIGALISSTIAIRAYKRKSLNLSGAIAGFLVMTIHFAVSYR 49 >ref|XP_007013286.1| Integral membrane protein-like isoform 3 [Theobroma cacao] gi|508783649|gb|EOY30905.1| Integral membrane protein-like isoform 3 [Theobroma cacao] Length = 248 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 MEK L+QP +A +S I+ RSY +KSLDLSGA +GF V+TIH AV YR Sbjct: 1 MEKTLIQPLIAMLISFLIAIRSYGRKSLDLSGALSGFIVMTIHFAVGYR 49 >ref|XP_007013284.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|590577624|ref|XP_007013285.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|508783647|gb|EOY30903.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|508783648|gb|EOY30904.1| Integral membrane protein-like isoform 1 [Theobroma cacao] Length = 287 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 MEK L+QP +A +S I+ RSY +KSLDLSGA +GF V+TIH AV YR Sbjct: 1 MEKTLIQPLIAMLISFLIAIRSYGRKSLDLSGALSGFIVMTIHFAVGYR 49 >gb|EXB76245.1| Transmembrane protein 19 [Morus notabilis] Length = 311 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 ME+ L+QP +A +S+ I+ R+YR+KSLDLSGA +GF V++IH AV YR Sbjct: 1 MERTLMQPLIAVLISSLIAIRAYRRKSLDLSGAISGFIVMSIHIAVGYR 49 >ref|XP_004149856.1| PREDICTED: transmembrane protein 19-like [Cucumis sativus] gi|449508273|ref|XP_004163269.1| PREDICTED: transmembrane protein 19-like [Cucumis sativus] Length = 287 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 M+ L+QP VA +++ I+FR+YR+KSL+LSGA AGF V++ H A+NYR Sbjct: 1 MDNILIQPSVAVIIASIIAFRAYRRKSLNLSGALAGFIVMSTHFAINYR 49 >ref|XP_004287388.1| PREDICTED: transmembrane protein 19-like [Fragaria vesca subsp. vesca] Length = 287 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 M+ +L+QP +A +SA ++ R+YR+KSLD SGA AG AV+T+H AV YR Sbjct: 1 MDSHLIQPLIAFLISAFVAARAYRRKSLDFSGAVAGLAVMTLHIAVGYR 49 >ref|XP_002324403.2| hypothetical protein POPTR_0018s06340g [Populus trichocarpa] gi|550318158|gb|EEF02968.2| hypothetical protein POPTR_0018s06340g [Populus trichocarpa] Length = 287 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = +2 Query: 179 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVLTIHGAVNYR 325 ME ++QP VA +S I+ ++YR+KSLD++GA AGF V+T+H A++YR Sbjct: 1 MENVVIQPSVAVLISFVIAIKAYRRKSLDVTGAVAGFIVMTLHFAISYR 49