BLASTX nr result
ID: Mentha25_contig00037146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00037146 (667 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38566.1| hypothetical protein MIMGU_mgv1a017082mg [Mimulus... 60 5e-07 >gb|EYU38566.1| hypothetical protein MIMGU_mgv1a017082mg [Mimulus guttatus] Length = 94 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -3 Query: 128 ENTTASEDDRSTLFVNYASIAWHEMRRAWRGD---AAQRKPRKP 6 E + +DD +TLFVNYA++AWHEMRRAWRG+ A+QRKP +P Sbjct: 12 EKMPSLQDDYNTLFVNYAAVAWHEMRRAWRGNRSVASQRKPTEP 55