BLASTX nr result
ID: Mentha25_contig00036146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00036146 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39423.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus... 69 5e-10 gb|EYU39422.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus... 69 5e-10 gb|EYU39421.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus... 69 5e-10 gb|EPS59106.1| hypothetical protein M569_15703, partial [Genlise... 63 5e-08 ref|XP_007223380.1| hypothetical protein PRUPE_ppa003811mg [Prun... 58 2e-06 >gb|EYU39423.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus guttatus] Length = 490 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +1 Query: 163 NHRLPSPSPLSVDAPSSVRLSDILPYDGAPMPPYLRAVDALSASLVR 303 ++RLPSP PLS D+P +RLSDILPYDG PM YLRA+DALS SL R Sbjct: 31 SYRLPSPCPLSSDSPCRIRLSDILPYDGPPMATYLRALDALSTSLDR 77 >gb|EYU39422.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus guttatus] Length = 467 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +1 Query: 163 NHRLPSPSPLSVDAPSSVRLSDILPYDGAPMPPYLRAVDALSASLVR 303 ++RLPSP PLS D+P +RLSDILPYDG PM YLRA+DALS SL R Sbjct: 31 SYRLPSPCPLSSDSPCRIRLSDILPYDGPPMATYLRALDALSTSLDR 77 >gb|EYU39421.1| hypothetical protein MIMGU_mgv1a005295mg [Mimulus guttatus] Length = 342 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +1 Query: 163 NHRLPSPSPLSVDAPSSVRLSDILPYDGAPMPPYLRAVDALSASLVR 303 ++RLPSP PLS D+P +RLSDILPYDG PM YLRA+DALS SL R Sbjct: 31 SYRLPSPCPLSSDSPCRIRLSDILPYDGPPMATYLRALDALSTSLDR 77 >gb|EPS59106.1| hypothetical protein M569_15703, partial [Genlisea aurea] Length = 446 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +1 Query: 160 QNHRLPSPSPLSVDAPSSVRLSDILPYDGAPMPPYLRAVDALSASLVR 303 + H PS S+D P VR+SDILPYDGAP+ YLRAVDALSASL R Sbjct: 8 REHSEQFPSFFSLDGPEKVRISDILPYDGAPLSRYLRAVDALSASLTR 55 >ref|XP_007223380.1| hypothetical protein PRUPE_ppa003811mg [Prunus persica] gi|462420316|gb|EMJ24579.1| hypothetical protein PRUPE_ppa003811mg [Prunus persica] Length = 547 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 8/54 (14%) Frame = +1 Query: 166 HRLPSPSPLSVDAPSS--------VRLSDILPYDGAPMPPYLRAVDALSASLVR 303 H LP P+P VD P+S VRLSDI PYDGAP PYLRAV+ALS SL+R Sbjct: 48 HALPLPAP-PVDHPASTIPCPLARVRLSDIAPYDGAPCGPYLRAVEALSGSLMR 100