BLASTX nr result
ID: Mentha25_contig00036020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00036020 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39255.1| hypothetical protein MIMGU_mgv1a004229mg [Mimulus... 67 3e-09 >gb|EYU39255.1| hypothetical protein MIMGU_mgv1a004229mg [Mimulus guttatus] Length = 538 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 6/61 (9%) Frame = +3 Query: 240 MEALKASSFPSFHRQPIST---RTIFQRPSVHIPSSRRITTFLP---TQKSNFKIFTATA 401 MEAL+ASSFPSFH PIST RTI ++P+ HIPS ++ITT L ++K+NFK+FTA + Sbjct: 1 MEALRASSFPSFHPPPISTKLPRTISEKPNFHIPSIQQITTPLSKIRSKKANFKVFTAIS 60 Query: 402 P 404 P Sbjct: 61 P 61