BLASTX nr result
ID: Mentha25_contig00034462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00034462 (572 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359432.1| PREDICTED: protein TRANSPORT INHIBITOR RESPO... 83 6e-14 ref|NP_001234673.1| TIR1-like protein [Solanum lycopersicum] gi|... 83 6e-14 ref|XP_006389669.1| TRANSPORT INHIBITOR RESPONSE 1 family protei... 83 6e-14 gb|EYU46730.1| hypothetical protein MIMGU_mgv1a003374mg [Mimulus... 82 1e-13 gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus not... 82 1e-13 ref|XP_002878489.1| hypothetical protein ARALYDRAFT_907876 [Arab... 82 1e-13 ref|XP_002520681.1| TRANSPORT INHIBITOR RESPONSE 1 protein, puta... 82 1e-13 ref|XP_006402320.1| hypothetical protein EUTSA_v10005852mg [Eutr... 82 1e-13 gb|ADG38664.1| AT3G62980-like protein [Neslia paniculata] 82 1e-13 ref|XP_007050790.1| F-box/RNI-like superfamily protein isoform 1... 80 3e-13 ref|XP_007163058.1| hypothetical protein PHAVU_001G202600g [Phas... 80 3e-13 ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabido... 80 4e-13 ref|XP_006290792.1| hypothetical protein CARUB_v10016894mg [Caps... 80 4e-13 ref|XP_006290791.1| hypothetical protein CARUB_v10016894mg [Caps... 80 4e-13 dbj|BAD94031.1| transport inhibitor response 1 [Arabidopsis thal... 80 4e-13 gb|ADL70210.1| transport inhibitor response 1 [Arabidopsis thali... 80 4e-13 gb|ADL70208.1| transport inhibitor response 1 [Arabidopsis thali... 80 4e-13 gb|ADL70207.1| transport inhibitor response 1 [Arabidopsis thali... 80 4e-13 gb|ADB92045.2| transport inhibitor response 1 [Arabidopsis thali... 80 4e-13 gb|ADB92044.2| transport inhibitor response 1 [Arabidopsis thali... 80 4e-13 >ref|XP_006359432.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Solanum tuberosum] Length = 581 Score = 82.8 bits (203), Expect = 6e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 567 ACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 ACK+LAQKMP LNVEVIDERGPP+TRPESCPVE++YIYRTVA Sbjct: 518 ACKMLAQKMPRLNVEVIDERGPPDTRPESCPVEKLYIYRTVA 559 >ref|NP_001234673.1| TIR1-like protein [Solanum lycopersicum] gi|256427109|gb|ACU81102.1| TIR1-like protein [Solanum lycopersicum] Length = 581 Score = 82.8 bits (203), Expect = 6e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 567 ACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 ACK+LAQKMP LNVEVIDERGPP+TRPESCPVE++YIYRTVA Sbjct: 518 ACKMLAQKMPRLNVEVIDERGPPDTRPESCPVEKLYIYRTVA 559 >ref|XP_006389669.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa] gi|550312551|gb|ERP48583.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa] Length = 584 Score = 82.8 bits (203), Expect = 6e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPPE+RPESCPVE++YIYRT+A Sbjct: 520 GACKLLGQKMPRLNVEVIDERGPPESRPESCPVEKLYIYRTIA 562 >gb|EYU46730.1| hypothetical protein MIMGU_mgv1a003374mg [Mimulus guttatus] Length = 589 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTV 445 GACK+L QKMP LNVEVIDERGPP TRPESCPVER+Y+YRTV Sbjct: 517 GACKLLGQKMPRLNVEVIDERGPPNTRPESCPVERLYVYRTV 558 >gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis] Length = 582 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPP+TRPESCPVE++YIYR+VA Sbjct: 517 GACKLLGQKMPRLNVEVIDERGPPDTRPESCPVEKLYIYRSVA 559 >ref|XP_002878489.1| hypothetical protein ARALYDRAFT_907876 [Arabidopsis lyrata subsp. lyrata] gi|297324327|gb|EFH54748.1| hypothetical protein ARALYDRAFT_907876 [Arabidopsis lyrata subsp. lyrata] Length = 635 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPP++RPESCPVERV+IYRT+A Sbjct: 521 GACKLLGQKMPKLNVEVIDERGPPDSRPESCPVERVFIYRTLA 563 >ref|XP_002520681.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223540066|gb|EEF41643.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] Length = 585 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPP+TRPESCPVE++YIYR+VA Sbjct: 521 GACKLLGQKMPRLNVEVIDERGPPDTRPESCPVEKLYIYRSVA 563 >ref|XP_006402320.1| hypothetical protein EUTSA_v10005852mg [Eutrema salsugineum] gi|557103419|gb|ESQ43773.1| hypothetical protein EUTSA_v10005852mg [Eutrema salsugineum] Length = 594 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPP++RPESCPVERV+IYR+VA Sbjct: 521 GACKLLGQKMPKLNVEVIDERGPPDSRPESCPVERVFIYRSVA 563 >gb|ADG38664.1| AT3G62980-like protein [Neslia paniculata] Length = 164 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTV 445 GACK+L QKMP LNVEVIDERGPP++RPESCPVERV+IYRTV Sbjct: 123 GACKLLGQKMPKLNVEVIDERGPPDSRPESCPVERVFIYRTV 164 >ref|XP_007050790.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|590718325|ref|XP_007050791.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508703051|gb|EOX94947.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508703052|gb|EOX94948.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 587 Score = 80.5 bits (197), Expect = 3e-13 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERGPP++RPESCPVE++YIYR+VA Sbjct: 522 GACKLLGQKMPRLNVEVIDERGPPDSRPESCPVEKLYIYRSVA 564 >ref|XP_007163058.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris] gi|319428659|gb|ADV56682.1| F-box/leucine rich repeat protein [Phaseolus vulgaris] gi|561036522|gb|ESW35052.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris] Length = 591 Score = 80.5 bits (197), Expect = 3e-13 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACKVL QKMP LNVEVIDERGPP++RP++CPVE++YIYRT+A Sbjct: 522 GACKVLGQKMPRLNVEVIDERGPPDSRPDNCPVEKLYIYRTIA 564 >ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana] gi|68053009|sp|Q570C0.2|TIR1_ARATH RecName: Full=Protein TRANSPORT INHIBITOR RESPONSE 1; AltName: Full=Weak ethylene-insensitive protein 1 gi|146387658|pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure gi|146387660|pdb|2P1N|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387663|pdb|2P1N|E Chain E, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387666|pdb|2P1O|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387669|pdb|2P1P|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387671|pdb|2P1Q|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|185177934|pdb|3C6N|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|185177936|pdb|3C6O|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate Interactions In Auxin Perception And Signaling gi|185177938|pdb|3C6P|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|2352492|gb|AAB69175.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|2352494|gb|AAB69176.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|7573427|emb|CAB87743.1| transport inhibitor response 1 (TIR1) [Arabidopsis thaliana] gi|25054937|gb|AAN71945.1| putative transport inhibitor response TIR1, AtFBL1 protein [Arabidopsis thaliana] gi|332646898|gb|AEE80419.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana] Length = 594 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 521 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 563 >ref|XP_006290792.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] gi|482559499|gb|EOA23690.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] Length = 594 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 521 GACKLLGQKMPKLNVEVIDERGSPDSRPESCPVERVFIYRTVA 563 >ref|XP_006290791.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] gi|482559498|gb|EOA23689.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] Length = 437 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 364 GACKLLGQKMPKLNVEVIDERGSPDSRPESCPVERVFIYRTVA 406 >dbj|BAD94031.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 226 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 153 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 195 >gb|ADL70210.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 261 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 188 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 230 >gb|ADL70208.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 247 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 174 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 216 >gb|ADL70207.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307833|gb|ADL70211.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 230 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 157 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 199 >gb|ADB92045.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|296593120|gb|ADB92046.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307819|gb|ADL70204.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307823|gb|ADL70206.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307835|gb|ADL70212.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307837|gb|ADL70213.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307839|gb|ADL70214.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307841|gb|ADL70215.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307843|gb|ADL70216.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 248 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 175 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 217 >gb|ADB92044.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307829|gb|ADL70209.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 249 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 570 GACKVLAQKMPSLNVEVIDERGPPETRPESCPVERVYIYRTVA 442 GACK+L QKMP LNVEVIDERG P++RPESCPVERV+IYRTVA Sbjct: 176 GACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVA 218