BLASTX nr result
ID: Mentha25_contig00034180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00034180 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30223.1| hypothetical protein MIMGU_mgv1a007051mg [Mimulus... 64 3e-08 ref|XP_007045378.1| 1-phosphatidylinositol-4-phosphate 5-kinase,... 56 6e-06 >gb|EYU30223.1| hypothetical protein MIMGU_mgv1a007051mg [Mimulus guttatus] Length = 421 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 381 GWRHGRFLRINIDGTRAEELWKEGVLVSEKQLD 283 GWR+G FLRIN+DGTR++ELW EGVLVSEKQLD Sbjct: 383 GWRNGNFLRINVDGTRSQELWDEGVLVSEKQLD 415 >ref|XP_007045378.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative isoform 1 [Theobroma cacao] gi|508709313|gb|EOY01210.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative isoform 1 [Theobroma cacao] Length = 779 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 381 GWRHGRFLRINIDGTRAEELWKEGVLVSEKQLDHD 277 GWRHG FL IN+DG R+ E+W EGVL+S +QLD D Sbjct: 741 GWRHGHFLCINVDGARSIEIWNEGVLMSRQQLDAD 775