BLASTX nr result
ID: Mentha25_contig00033302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033302 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43883.1| hypothetical protein MIMGU_mgv1a008684mg [Mimulus... 72 8e-11 >gb|EYU43883.1| hypothetical protein MIMGU_mgv1a008684mg [Mimulus guttatus] Length = 365 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/72 (52%), Positives = 52/72 (72%) Frame = +1 Query: 4 VKKQEPHYEAPIPQDTVQNGVEDSLPPDLLLIKPVEAVKFVKNMEESRPLKVVDSEKPIP 183 V KQEP +E +P+D ++NGVE PD+LL K VEA++ VK MEE R LKVV++ KP+P Sbjct: 164 VIKQEPSFETFMPKDKLKNGVEYFSRPDMLLEK-VEAIQNVKKMEEPRSLKVVENVKPVP 222 Query: 184 AKVEEFYADRDD 219 AK EEF+ + + Sbjct: 223 AKDEEFFLQKKE 234