BLASTX nr result
ID: Mentha25_contig00033226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033226 (552 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30775.1| hypothetical protein MIMGU_mgv1a023439mg [Mimulus... 69 6e-10 >gb|EYU30775.1| hypothetical protein MIMGU_mgv1a023439mg [Mimulus guttatus] Length = 537 Score = 69.3 bits (168), Expect = 6e-10 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 14/130 (10%) Frame = -3 Query: 550 RAEIKSIDKIEAALLNEDKTTLRSDSSQLE--VHEKKEALPSK---------GLKTFQDF 404 R EIKSID I A LNE+KT R+DS QLE + E+KE + GL TF++ Sbjct: 348 RTEIKSID-ITRAALNEEKTKSRNDSGQLETFIEEEKEMVAISEETMRKKGGGLTTFEEL 406 Query: 403 LDDRGSPDQSNEEDPVFEKTLHVDTVHNIGPPNSRLFSS-NTQDSE--TAPKLLEGDAVK 233 L D P +SN PV EKTL+VDT+ ++ PN+ SS TQD++ + + + D V Sbjct: 407 LAD---PKESNSGFPVTEKTLYVDTIRSVESPNNLTSSSLTTQDTKHVSISRKEDHDTVT 463 Query: 232 SWRAVQMQAI 203 R QM AI Sbjct: 464 K-RMAQMNAI 472