BLASTX nr result
ID: Mentha25_contig00033079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033079 (537 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus... 69 7e-10 gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial... 66 5e-09 gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial... 64 1e-08 gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulu... 60 2e-08 gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial... 64 2e-08 gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus... 57 4e-08 gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial... 62 7e-08 gb|EYU41845.1| hypothetical protein MIMGU_mgv1a022342mg, partial... 58 8e-08 gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulu... 62 9e-08 gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus... 61 1e-07 gb|EYU38950.1| hypothetical protein MIMGU_mgv1a018469mg, partial... 61 2e-07 gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus... 60 4e-07 gb|EYU26971.1| hypothetical protein MIMGU_mgv1a025965mg, partial... 60 4e-07 gb|EYU22997.1| hypothetical protein MIMGU_mgv1a022018mg, partial... 60 4e-07 gb|EYU18208.1| hypothetical protein MIMGU_mgv1a024413mg, partial... 59 7e-07 gb|EYU18095.1| hypothetical protein MIMGU_mgv1a006925mg [Mimulus... 58 2e-06 gb|EYU26413.1| hypothetical protein MIMGU_mgv1a006946mg [Mimulus... 50 2e-06 gb|EYU41902.1| hypothetical protein MIMGU_mgv1a018408mg [Mimulus... 53 2e-06 gb|EYU41906.1| hypothetical protein MIMGU_mgv1a0231983mg, partia... 53 2e-06 gb|EYU25809.1| hypothetical protein MIMGU_mgv1a021367mg, partial... 57 3e-06 >gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus guttatus] Length = 460 Score = 68.9 bits (167), Expect = 7e-10 Identities = 55/120 (45%), Positives = 67/120 (55%), Gaps = 15/120 (12%) Frame = -2 Query: 488 VGRIMIRLS--LESR*ERSTRYMGILKLL---------SSFNLSKAWN*YHLEVSGEDIE 342 V R+ + LS L++R R RY +LL S+F KA + + VS E IE Sbjct: 139 VQRVEVDLSSNLDNRRARPLRYSFPKELLDQNNRGVVSSNFKSLKALSLNRVNVSSEAIE 198 Query: 341 LFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCGK--SIKVSAPNLT 174 FLRNCPLLE LT+ S++EV G S LKHLEITD C K S+KVSAPNLT Sbjct: 199 FFLRNCPLLEQLTVHNEKELSNLEVWGSSLVLKHLEITD------CDKLRSLKVSAPNLT 252 >gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial [Mimulus guttatus] Length = 357 Score = 66.2 bits (160), Expect = 5e-09 Identities = 43/95 (45%), Positives = 56/95 (58%), Gaps = 4/95 (4%) Frame = -2 Query: 401 FNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDH 228 F KA + +++SGE IE FLRNCP LE L +R V+ S++EVCGPS LKHLEI Sbjct: 178 FKSLKALSLKCVKLSGEAIEFFLRNCPFLEKLVLRNVNGISNLEVCGPSLALKHLEI--- 234 Query: 227 TSEFRCG--KSIKVSAPNLTXXXXXXXXXCIL*NI 129 + C KS++VS PNLT +L N+ Sbjct: 235 ---WFCAKLKSVRVSGPNLTSFYSSHVEVLLLENV 266 >gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial [Mimulus guttatus] Length = 340 Score = 63.9 bits (154), Expect(2) = 1e-08 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 4/83 (4%) Frame = -2 Query: 410 LSSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEI 237 LS F KA + +++SG IE FLRNCPLLE L + + S +EVCG S LKHLEI Sbjct: 149 LSDFKSLKALSFKSVDLSGGAIEFFLRNCPLLEQLIVHSARKLSKLEVCGSSLVLKHLEI 208 Query: 236 TDHTSEFRCG--KSIKVSAPNLT 174 RC KS+KV+AP+LT Sbjct: 209 V------RCPFLKSLKVAAPSLT 225 Score = 20.8 bits (42), Expect(2) = 1e-08 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 537 EFVFLRKVESLKLDF 493 EF F + V+ L+LDF Sbjct: 112 EFAFSKHVQRLELDF 126 >gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulus guttatus] Length = 421 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 38/77 (49%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = -2 Query: 401 FNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDH 228 F KA + + + G +IELFLRNCPLLE L + IEVCGPS LKHLEI + Sbjct: 137 FKSLKALSLKRVTLRGGEIELFLRNCPLLEQLIVHTAWNIPTIEVCGPSLVLKHLEIVNC 196 Query: 227 TSEFRCGKSIKVSAPNL 177 T +S+KV APNL Sbjct: 197 TGL----QSLKVYAPNL 209 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -1 Query: 537 EFVFLRKVESLKLDFHCGADHDKVVLGESLREINTIYG-NPQTLIFFQSLKSLEL 376 EF F R V SL+LDF V + N ++ T++ F+SLK+L L Sbjct: 99 EFAFSRHVRSLELDF--------PVYYNNFCFPNELFAPRSNTVLEFKSLKALSL 145 >gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial [Mimulus guttatus] Length = 252 Score = 63.9 bits (154), Expect = 2e-08 Identities = 44/91 (48%), Positives = 51/91 (56%), Gaps = 2/91 (2%) Frame = -2 Query: 443 RSTRYMGILKLLSSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVC 264 RS +G K L +L K + + G DIELFLRNCPLLE L + S IEVC Sbjct: 150 RSNMVLGF-KSLKELSLKK------VNLRGGDIELFLRNCPLLEQLIVHTTWTVSKIEVC 202 Query: 263 GPS--LKHLEITDHTSEFRCGKSIKVSAPNL 177 GPS LKHLEI T +S+KV APNL Sbjct: 203 GPSLVLKHLEIVKCTGL----ESLKVYAPNL 229 >gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus guttatus] Length = 324 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 3/67 (4%) Frame = -2 Query: 368 LEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCG-KSI 198 L V+G+ IE+ LR CPLLE L + + S++EVCGPS LKH E+ + G +S+ Sbjct: 162 LNVTGQAIEILLRMCPLLEKLVVHRTTKISNLEVCGPSLVLKHFELV-----YCFGLESV 216 Query: 197 KVSAPNL 177 KVSAPNL Sbjct: 217 KVSAPNL 223 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -1 Query: 537 EFVFLRKVESLKLDFHCGADHDKVV-LGESLR-EINTIYGNPQTLIFFQSLKSLEL 376 EF F+R V+ L LDF A + + +LR E T + I F+SLK L L Sbjct: 104 EFAFMRHVQKLDLDFSVLARYKRFTETHYTLREEFLTRISGGNSCIGFKSLKELSL 159 >gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial [Mimulus guttatus] Length = 367 Score = 62.4 bits (150), Expect = 7e-08 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 2/78 (2%) Frame = -2 Query: 404 SFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITD 231 +F KA + + V+GE IE FLRNCP LE L + S S++EVCGPS LKHL++ Sbjct: 176 NFKSLKALSLKCVNVTGEAIEFFLRNCPSLEKLVVTYTSKLSNLEVCGPSLALKHLDL-- 233 Query: 230 HTSEFRCGKSIKVSAPNL 177 FR KS+KVSAPNL Sbjct: 234 -RFCFRL-KSVKVSAPNL 249 >gb|EYU41845.1| hypothetical protein MIMGU_mgv1a022342mg, partial [Mimulus guttatus] Length = 219 Score = 57.8 bits (138), Expect(2) = 8e-08 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = -2 Query: 368 LEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCGKSIK 195 + ++G+ IE FL NCP LE L + + S++EVCGPS LKHLE+ H + +S+K Sbjct: 117 VNLTGQAIEFFLHNCPFLEKLVVHYTNKISNLEVCGPSLVLKHLELM-HCNYL---ESVK 172 Query: 194 VSAPNL 177 VSAPNL Sbjct: 173 VSAPNL 178 Score = 24.3 bits (51), Expect(2) = 8e-08 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = -1 Query: 537 EFVFLRKVESLKLDF-----HCGADHDKVVLGESLREINTIYGNPQTLIFFQSLKSLEL 376 EF F R V+ L LDF + + L E T GN + I F+SLK L L Sbjct: 58 EFAFTRHVQKLDLDFSVKVKNKTSPRTHYTLPEEFLTRRTSGGN--SCIDFKSLKELSL 114 >gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulus guttatus] Length = 464 Score = 62.0 bits (149), Expect = 9e-08 Identities = 43/108 (39%), Positives = 54/108 (50%), Gaps = 2/108 (1%) Frame = -2 Query: 416 KLLSSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHL 243 ++L F K + + VS IELFL NCPLLE L + S +EVCGPS LKHL Sbjct: 177 RMLFDFTSLKELSFKSIIVSDRAIELFLHNCPLLEQLIVHYSQKISKLEVCGPSLMLKHL 236 Query: 242 EITDHTSEFRCGKSIKVSAPNLTXXXXXXXXXCIL*NIHIRICYAPFC 99 EI T KS+KVSAP LT +L N+ + + C Sbjct: 237 EIVHCTGL----KSLKVSAPRLTTLNVTVLKVVLLENVPMLVDLTGSC 280 >gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus guttatus] Length = 532 Score = 61.2 bits (147), Expect = 1e-07 Identities = 43/104 (41%), Positives = 54/104 (51%), Gaps = 3/104 (2%) Frame = -2 Query: 401 FNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITD- 231 F KA + + VSGE IE FLR CP LE L + S S++EVCG S LKHLE+ Sbjct: 380 FKSLKALSMRFVNVSGEAIEFFLRTCPFLEKLVVHNASELSNLEVCGSSLDLKHLELQSC 439 Query: 230 HTSEFRCGKSIKVSAPNLTXXXXXXXXXCIL*NIHIRICYAPFC 99 H SIKVSAPNLT +L N+ + + + C Sbjct: 440 HNL-----TSIKVSAPNLTSLTLPNVKGLLLENVPMLVEVSVSC 478 >gb|EYU38950.1| hypothetical protein MIMGU_mgv1a018469mg, partial [Mimulus guttatus] Length = 254 Score = 60.8 bits (146), Expect = 2e-07 Identities = 37/65 (56%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = -2 Query: 362 VSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCGKSIKVS 189 V+ + IE FL NCPLLE L +R VS S++EVCG S LKHLE+ H + KS+KVS Sbjct: 174 VTRKVIEFFLYNCPLLEKLVVRYVSQISNLEVCGSSLALKHLEL-KHCYDL---KSVKVS 229 Query: 188 APNLT 174 APNLT Sbjct: 230 APNLT 234 >gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus guttatus] Length = 469 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/80 (46%), Positives = 46/80 (57%), Gaps = 2/80 (2%) Frame = -2 Query: 362 VSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCGKSIKVS 189 VSGE IE FLR CPLLE L ++ S S++EVCG S LKHL++ KS+KVS Sbjct: 212 VSGEAIEFFLRKCPLLEKLVVQNASQISNLEVCGSSLALKHLKLKSCYDL----KSVKVS 267 Query: 188 APNLTXXXXXXXXXCIL*NI 129 APNL +L N+ Sbjct: 268 APNLASLSILDAEGLLLENV 287 >gb|EYU26971.1| hypothetical protein MIMGU_mgv1a025965mg, partial [Mimulus guttatus] Length = 424 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = -2 Query: 368 LEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEFRCGKSIK 195 + +SG IE FL NCPLLE L + S +EVCGPS LKHLE+ D +F K++K Sbjct: 215 VNLSGAAIEFFLHNCPLLERLVVHRSRKISSLEVCGPSLRLKHLELID-CYDF---KTLK 270 Query: 194 VSAPNLT 174 VS PNLT Sbjct: 271 VSLPNLT 277 >gb|EYU22997.1| hypothetical protein MIMGU_mgv1a022018mg, partial [Mimulus guttatus] Length = 362 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/79 (48%), Positives = 48/79 (60%), Gaps = 2/79 (2%) Frame = -2 Query: 407 SSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEIT 234 S F +A + VS +DI+ FLRNCPLLE L + S++E+CGPS LKHLEI Sbjct: 157 SRFKSIRALTFKDVSVSEKDIDFFLRNCPLLEELIVFNSPALSNLEICGPSLALKHLEIV 216 Query: 233 DHTSEFRCGKSIKVSAPNL 177 R KS++VSAPNL Sbjct: 217 ----FCRRLKSLRVSAPNL 231 >gb|EYU18208.1| hypothetical protein MIMGU_mgv1a024413mg, partial [Mimulus guttatus] Length = 314 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/79 (46%), Positives = 47/79 (59%), Gaps = 2/79 (2%) Frame = -2 Query: 404 SFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITD 231 SF K + + +S IE FL NCPLLE L +R + S ++VCGPS LKHLEI Sbjct: 34 SFKSLKELSFNSVHLSDGVIESFLNNCPLLERLVVRLTNKISIVQVCGPSLRLKHLEIVY 93 Query: 230 HTSEFRCGKSIKVSAPNLT 174 T KS+++SAPNLT Sbjct: 94 CTGL----KSLRISAPNLT 108 >gb|EYU18095.1| hypothetical protein MIMGU_mgv1a006925mg [Mimulus guttatus] Length = 426 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/74 (47%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = -2 Query: 389 KAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEITDHTSEF 216 KA + + V+ +E FLRNCPLLE LT+ D+EVCGPS LKHL++ HT +F Sbjct: 155 KALSLVSVHVTDGAVEFFLRNCPLLEELTVCCSHKFLDLEVCGPSLVLKHLDL-QHTYDF 213 Query: 215 RCGKSIKVSAPNLT 174 R ++K+ AP LT Sbjct: 214 R---TLKICAPFLT 224 >gb|EYU26413.1| hypothetical protein MIMGU_mgv1a006946mg [Mimulus guttatus] Length = 425 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 3/68 (4%) Frame = -2 Query: 368 LEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS---LKHLEITDHTSEFRCGKSI 198 + +SG IE LRNC LLE L ++ T+ ++VCG S L+HLE+ H KS+ Sbjct: 173 VSLSGGAIEFLLRNCQLLEQLVVQESETTTKLQVCGGSSLKLEHLEMV-HCQGL---KSL 228 Query: 197 KVSAPNLT 174 KVSAP LT Sbjct: 229 KVSAPRLT 236 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 537 EFVFLRKVESLKLDFHCGADHDKVVLGESLREINTIYGNPQTLIFFQSLKSL 382 EF F R++E L LDF E+L N TL+ F+SLK++ Sbjct: 124 EFAFARQLERLTLDFQENTTGTTYCFPEALL-------NRSTLVGFKSLKAI 168 >gb|EYU41902.1| hypothetical protein MIMGU_mgv1a018408mg [Mimulus guttatus] Length = 355 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 30/80 (37%), Positives = 45/80 (56%) Frame = -2 Query: 413 LLSSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPSLKHLEIT 234 L ++F K + L V+ EDI+ FLRNCPLLE L + S +E+CG SL+ + Sbjct: 151 LSNNFKSIKVLSFKCLNVTDEDIDFFLRNCPLLEQLIVHGSEKISKLEICGSSLRLKHLD 210 Query: 233 DHTSEFRCGKSIKVSAPNLT 174 H KS+++S P++T Sbjct: 211 MHCCYNM--KSLEISVPSIT 228 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 537 EFVFLRKVESLKLDFH 490 EF F R+VE L+ DF+ Sbjct: 114 EFAFSRRVEKLEFDFY 129 >gb|EYU41906.1| hypothetical protein MIMGU_mgv1a0231983mg, partial [Mimulus guttatus] Length = 219 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 30/80 (37%), Positives = 45/80 (56%) Frame = -2 Query: 413 LLSSFNLSKAWN*YHLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPSLKHLEIT 234 L ++F K + L V+ EDI+ FLRNCPLLE L + S +E+CG SL+ + Sbjct: 116 LSNNFKSIKVLSFKCLNVTDEDIDFFLRNCPLLEQLIVHGSEKISKLEICGSSLRLKHLD 175 Query: 233 DHTSEFRCGKSIKVSAPNLT 174 H KS+++S P++T Sbjct: 176 MHCCYNM--KSLEISVPSIT 193 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 537 EFVFLRKVESLKLDFH 490 EF F R+VE L+ DF+ Sbjct: 79 EFAFSRRVEKLEFDFY 94 >gb|EYU25809.1| hypothetical protein MIMGU_mgv1a021367mg, partial [Mimulus guttatus] Length = 212 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 371 HLEVSGEDIELFLRNCPLLELLTIRAVSLTSDIEVCGPS--LKHLEI 237 H+ VSG IE FLRNCPLLE LT+ ++ S +EVCG S LKHLEI Sbjct: 166 HVNVSGGSIESFLRNCPLLEKLTVHSLGKLSKLEVCGSSLVLKHLEI 212