BLASTX nr result
ID: Mentha25_contig00033012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033012 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39197.1| hypothetical protein MIMGU_mgv1a002547mg [Mimulus... 59 9e-07 >gb|EYU39197.1| hypothetical protein MIMGU_mgv1a002547mg [Mimulus guttatus] Length = 660 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -1 Query: 351 GKGARKAGPLTLMLSKFSAKLRGKPWEPPKPAESG--RSNTKYKLI 220 GKGA K GPL+L+LS+ SAKLRGK WEPPKP+ S +S+ YKL+ Sbjct: 598 GKGAEK-GPLSLLLSRLSAKLRGKQWEPPKPSSSSSKKSSVNYKLV 642