BLASTX nr result
ID: Mentha25_contig00032494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032494 (1207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39419.1| hypothetical protein MIMGU_mgv1a010384mg [Mimulus... 59 3e-06 >gb|EYU39419.1| hypothetical protein MIMGU_mgv1a010384mg [Mimulus guttatus] Length = 313 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 57 RLIDESKHCNLKSAHPSGLSAHMGFFGCRVFS 152 RLIDESKH LKSAHPSGLSAH GFFGCR FS Sbjct: 264 RLIDESKHYVLKSAHPSGLSAHRGFFGCRHFS 295