BLASTX nr result
ID: Mentha25_contig00032349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032349 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34101.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus... 75 7e-12 >gb|EYU34101.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus guttatus] gi|604328543|gb|EYU34102.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus guttatus] Length = 566 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +2 Query: 245 MGKSAGKWIKTVLFGKKHSKSNYSKNVTPDKKSAVKTPNEDPARDSSFI 391 MGKSAGKWIKTVLFGKK+SKSN+SKNVTPDK++ KTP ED +S I Sbjct: 1 MGKSAGKWIKTVLFGKKYSKSNFSKNVTPDKRTGQKTPAEDLPGNSPVI 49