BLASTX nr result
ID: Mentha25_contig00032287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032287 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028975.1| DNA-binding bromodomain-containing protein, ... 62 8e-08 >ref|XP_007028975.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] gi|508717580|gb|EOY09477.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] Length = 693 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = -2 Query: 317 AEAKGENKKSQSTSDSKKRGAANFLSRLKQGSSPNNGVLLDALKNTPLTTESTTGKG-GS 141 +E+K E +K+ + SKKR AANFL+R+++ SS NNG L++ LK S GKG G Sbjct: 556 SESKAEKEKTNANISSKKRSAANFLNRMRRSSSSNNGPLIETLKG---VISSDNGKGDGG 612 Query: 140 DQKKNEPAKRGEKK 99 +QKKN +K ++K Sbjct: 613 EQKKNSNSKGDQRK 626