BLASTX nr result
ID: Mentha25_contig00032262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032262 (535 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42848.1| hypothetical protein MIMGU_mgv1a005257mg [Mimulus... 60 4e-07 >gb|EYU42848.1| hypothetical protein MIMGU_mgv1a005257mg [Mimulus guttatus] Length = 491 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/66 (54%), Positives = 40/66 (60%) Frame = -2 Query: 198 DSKDSKFNRQLQSGPCNSSLERKSTTSGSVXXXXXXXXXXXXXXALHDAEFQVTLLESRN 19 DS DSK N QLQ+ S+LER+S S SV ALHDA FQV LLESR+ Sbjct: 2 DSTDSKSNTQLQTAVRYSTLERRSPASPSVIVIGAGFAGIAAARALHDASFQVILLESRD 61 Query: 18 RIGGRV 1 RIGGRV Sbjct: 62 RIGGRV 67