BLASTX nr result
ID: Mentha25_contig00031993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00031993 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34990.1| hypothetical protein MIMGU_mgv1a007888mg [Mimulus... 63 4e-08 ref|XP_006597117.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 57 3e-06 ref|XP_003604379.1| Glucan endo-1,3-beta-glucosidase [Medicago t... 56 4e-06 gb|EXB67295.1| Glucan endo-1,3-beta-glucosidase 11 [Morus notabi... 55 8e-06 ref|XP_007013485.1| Glycosyl hydrolase superfamily protein [Theo... 55 8e-06 >gb|EYU34990.1| hypothetical protein MIMGU_mgv1a007888mg [Mimulus guttatus] Length = 392 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 346 AGSEKYYGLFKADGSISYDLGLPGLKSSSAPS-SFFTFKDRGSGKL 212 AGSEKYYGLFKADGSISYD+G GLKSSSA S S +FKD G++ Sbjct: 325 AGSEKYYGLFKADGSISYDIGFSGLKSSSASSLSRVSFKDFRGGRM 370 >ref|XP_006597117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X1 [Glycine max] Length = 386 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -1 Query: 340 SEKYYGLFKADGSISYDLGLPGLKSSSAPSSFFTFKDRGSGKLHGWCSF 194 SE+ +GLFKADGSI+YD+G GL SSA SSF +FK GS + + SF Sbjct: 330 SERNFGLFKADGSIAYDIGFTGLVPSSATSSFLSFKGIGSSFMMAFTSF 378 >ref|XP_003604379.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] gi|355505434|gb|AES86576.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] Length = 391 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 343 GSEKYYGLFKADGSISYDLGLPGLKSSSAPSSFFTFKDRGS 221 GSE+++GLF DGSI+YD+G GLK SSA SSF +FK GS Sbjct: 332 GSERHFGLFNHDGSIAYDIGFTGLKPSSATSSFLSFKGIGS 372 >gb|EXB67295.1| Glucan endo-1,3-beta-glucosidase 11 [Morus notabilis] Length = 457 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 340 SEKYYGLFKADGSISYDLGLPGLKSSSAPSSFFTFKDRG 224 SE+ +GLFK DGSISYD+G GL SSAPSS +FKD G Sbjct: 328 SERNFGLFKPDGSISYDIGFTGLVPSSAPSSLLSFKDLG 366 >ref|XP_007013485.1| Glycosyl hydrolase superfamily protein [Theobroma cacao] gi|508783848|gb|EOY31104.1| Glycosyl hydrolase superfamily protein [Theobroma cacao] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 340 SEKYYGLFKADGSISYDLGLPGLKSSSAPSSFFTFKDRGSGKLHGW 203 SE+ +GLFK DGSISYD+G GLKSSSA SS + KD +G +G+ Sbjct: 328 SERNFGLFKPDGSISYDIGFHGLKSSSADSSLSSLKDIRAGSWYGF 373