BLASTX nr result
ID: Mentha25_contig00031991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00031991 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34990.1| hypothetical protein MIMGU_mgv1a007888mg [Mimulus... 64 2e-08 >gb|EYU34990.1| hypothetical protein MIMGU_mgv1a007888mg [Mimulus guttatus] Length = 392 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/60 (61%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +3 Query: 3 FNEDSKGGAGSEKYYGLFKADGSISYDLGLPGLK-XXXXXXXXXXXKD-RGSGTLHGSYS 176 FNE+SK GAGSEKYYGLFKADGSISYD+G GLK KD RG GSYS Sbjct: 317 FNENSKPGAGSEKYYGLFKADGSISYDIGFSGLKSSSASSLSRVSFKDFRGGRMWAGSYS 376