BLASTX nr result
ID: Mentha25_contig00031654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00031654 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus... 72 6e-11 >gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus guttatus] Length = 316 Score = 72.4 bits (176), Expect = 6e-11 Identities = 45/97 (46%), Positives = 54/97 (55%), Gaps = 1/97 (1%) Frame = -2 Query: 398 KNIPEPSPTHQD-CSGESMKVDGVEDDTVEDNRGKRKAETASTMSSPGPGNSLDYGKSPF 222 K+ P P+ D S E+MKVD DD E GKRK E A S +Y KSP Sbjct: 220 KDSINPDPSSGDPVSDETMKVDESCDDVDEGVGGKRKGEEAMDKESSDQETVHEYVKSPA 279 Query: 221 KSSPKGESQVTESDSVAAKDNVQRQYKRQRRSAPKQR 111 S GES ++D V+ KD+VQR+YKR RRS PKQR Sbjct: 280 TSLTDGESVANKTDLVSGKDDVQRKYKRLRRSVPKQR 316