BLASTX nr result
ID: Mentha25_contig00031257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00031257 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus... 70 2e-10 >gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus guttatus] Length = 316 Score = 70.5 bits (171), Expect = 2e-10 Identities = 45/103 (43%), Positives = 56/103 (54%), Gaps = 1/103 (0%) Frame = -3 Query: 387 KNIPEPSPTHQD-CSGESMKVDRVEGDILEDSRGKRKEPATDKAETASTMSSPGPANSHD 211 K+ P P+ D S E+MKVD D+ E GKRK E A S H+ Sbjct: 220 KDSINPDPSSGDPVSDETMKVDESCDDVDEGVGGKRK------GEEAMDKESSDQETVHE 273 Query: 210 YGKSPFKSSPEGESHVTESDPLAAKDNVQRKYKRQRRSAPKQR 82 Y KSP S +GES ++D ++ KD+VQRKYKR RRS PKQR Sbjct: 274 YVKSPATSLTDGESVANKTDLVSGKDDVQRKYKRLRRSVPKQR 316