BLASTX nr result
ID: Mentha25_contig00031020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00031020 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362777.1| PREDICTED: ABC transporter F family member 5... 62 1e-07 ref|XP_004237462.1| PREDICTED: ABC transporter F family member 5... 62 1e-07 gb|ACK44498.1| AT5G09930-like protein [Arabidopsis arenosa] 62 1e-07 ref|XP_001770452.1| ATP-binding cassette transporter, subfamily ... 61 1e-07 ref|XP_001785649.1| ATP-binding cassette transporter, subfamily ... 60 2e-07 gb|EXC19706.1| ABC transporter F family member 5 [Morus notabilis] 60 3e-07 ref|NP_201289.1| general control non-repressible 5 [Arabidopsis ... 60 3e-07 ref|XP_006394104.1| hypothetical protein EUTSA_v10003741mg [Eutr... 60 3e-07 ref|XP_006279584.1| hypothetical protein CARUB_v10025997mg [Caps... 60 3e-07 ref|XP_002866638.1| ATGCN5 [Arabidopsis lyrata subsp. lyrata] gi... 60 3e-07 gb|AAL08291.1| AT5g64840/MXK3_6 [Arabidopsis thaliana] gi|233082... 60 3e-07 gb|EMT31225.1| ABC transporter F family member 5 [Aegilops tausc... 60 4e-07 ref|XP_003577375.1| PREDICTED: ABC transporter F family member 5... 60 4e-07 ref|XP_002449815.1| hypothetical protein SORBIDRAFT_05g023860 [S... 60 4e-07 gb|ACG26626.1| hypothetical protein [Zea mays] gi|223947735|gb|A... 60 4e-07 ref|NP_001105535.1| ABC family1 [Zea mays] gi|49073110|gb|AAT517... 60 4e-07 gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus... 59 5e-07 gb|EPS72789.1| hypothetical protein M569_01962, partial [Genlise... 59 5e-07 ref|XP_002963504.1| ATP-binding cassette transporter, subfamily ... 59 5e-07 ref|XP_002988216.1| hypothetical protein SELMODRAFT_127481 [Sela... 59 5e-07 >ref|XP_006362777.1| PREDICTED: ABC transporter F family member 5-like [Solanum tuberosum] Length = 695 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IPTKEMLE Sbjct: 558 CKFMVTPSTLLVLDEPTNHLDIPTKEMLE 586 >ref|XP_004237462.1| PREDICTED: ABC transporter F family member 5-like [Solanum lycopersicum] Length = 695 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IPTKEMLE Sbjct: 558 CKFMVTPSTLLVLDEPTNHLDIPTKEMLE 586 >gb|ACK44498.1| AT5G09930-like protein [Arabidopsis arenosa] Length = 696 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLEIYYLTFCFS 118 CKFMV PSTLLVLDEPTNHL+IP+KEMLE+ T FS Sbjct: 541 CKFMVKPSTLLVLDEPTNHLDIPSKEMLEVSNHTLLFS 578 >ref|XP_001770452.1| ATP-binding cassette transporter, subfamily F, member 7 protein PpABCF7 [Physcomitrella patens] gi|162678329|gb|EDQ64789.1| ATP-binding cassette transporter, subfamily F, member 7 protein PpABCF7 [Physcomitrella patens] Length = 618 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 LCKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 LCKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 480 LCKFMVTPSTLLILDEPTNHLDIPSKEMLE 509 >ref|XP_001785649.1| ATP-binding cassette transporter, subfamily F, member 8 protein PpABCF8 [Physcomitrella patens] gi|162662729|gb|EDQ49547.1| ATP-binding cassette transporter, subfamily F, member 8 protein PpABCF8 [Physcomitrella patens] Length = 638 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 LCKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 LCKFMVTPST+LVLDEPTNHL+IP+KEMLE Sbjct: 500 LCKFMVTPSTVLVLDEPTNHLDIPSKEMLE 529 >gb|EXC19706.1| ABC transporter F family member 5 [Morus notabilis] Length = 715 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 578 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 606 >ref|NP_201289.1| general control non-repressible 5 [Arabidopsis thaliana] gi|75335535|sp|Q9LV93.1|AB5F_ARATH RecName: Full=ABC transporter F family member 5; Short=ABC transporter ABCF.5; Short=AtABCF5; AltName: Full=GCN20-type ATP-binding cassette protein GCN5 gi|8843748|dbj|BAA97296.1| ABC transporter protein 1-like [Arabidopsis thaliana] gi|110742654|dbj|BAE99239.1| ABC transporter protein 1-like [Arabidopsis thaliana] gi|332010577|gb|AED97960.1| general control non-repressible 5 [Arabidopsis thaliana] Length = 692 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 555 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 583 >ref|XP_006394104.1| hypothetical protein EUTSA_v10003741mg [Eutrema salsugineum] gi|557090743|gb|ESQ31390.1| hypothetical protein EUTSA_v10003741mg [Eutrema salsugineum] Length = 694 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 557 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 585 >ref|XP_006279584.1| hypothetical protein CARUB_v10025997mg [Capsella rubella] gi|482548288|gb|EOA12482.1| hypothetical protein CARUB_v10025997mg [Capsella rubella] Length = 694 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 557 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 585 >ref|XP_002866638.1| ATGCN5 [Arabidopsis lyrata subsp. lyrata] gi|297312473|gb|EFH42897.1| ATGCN5 [Arabidopsis lyrata subsp. lyrata] Length = 694 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 557 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 585 >gb|AAL08291.1| AT5g64840/MXK3_6 [Arabidopsis thaliana] gi|23308219|gb|AAN18079.1| At5g64840/MXK3_6 [Arabidopsis thaliana] Length = 692 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLLVLDEPTNHL+IP+KEMLE Sbjct: 555 CKFMVTPSTLLVLDEPTNHLDIPSKEMLE 583 >gb|EMT31225.1| ABC transporter F family member 5 [Aegilops tauschii] Length = 635 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 498 CKFMVTPSTLLILDEPTNHLDIPSKEMLE 526 >ref|XP_003577375.1| PREDICTED: ABC transporter F family member 5-like [Brachypodium distachyon] Length = 690 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 553 CKFMVTPSTLLILDEPTNHLDIPSKEMLE 581 >ref|XP_002449815.1| hypothetical protein SORBIDRAFT_05g023860 [Sorghum bicolor] gi|241935658|gb|EES08803.1| hypothetical protein SORBIDRAFT_05g023860 [Sorghum bicolor] Length = 703 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 566 CKFMVTPSTLLILDEPTNHLDIPSKEMLE 594 >gb|ACG26626.1| hypothetical protein [Zea mays] gi|223947735|gb|ACN27951.1| unknown [Zea mays] gi|238009900|gb|ACR35985.1| unknown [Zea mays] gi|414591707|tpg|DAA42278.1| TPA: ABCF-type protein [Zea mays] Length = 705 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 568 CKFMVTPSTLLILDEPTNHLDIPSKEMLE 596 >ref|NP_001105535.1| ABC family1 [Zea mays] gi|49073110|gb|AAT51734.1| ABCF-type protein [Zea mays] Length = 705 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMVTPSTLL+LDEPTNHL+IP+KEMLE Sbjct: 568 CKFMVTPSTLLILDEPTNHLDIPSKEMLE 596 >gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus guttatus] Length = 718 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMV PSTLLVLDEPTNHL+IPTKEMLE Sbjct: 581 CKFMVKPSTLLVLDEPTNHLDIPTKEMLE 609 >gb|EPS72789.1| hypothetical protein M569_01962, partial [Genlisea aurea] Length = 723 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMV PSTLLVLDEPTNHL+IPTKEMLE Sbjct: 586 CKFMVKPSTLLVLDEPTNHLDIPTKEMLE 614 >ref|XP_002963504.1| ATP-binding cassette transporter, subfamily F, member 1, SmABCF1 [Selaginella moellendorffii] gi|300168772|gb|EFJ35375.1| ATP-binding cassette transporter, subfamily F, member 1, SmABCF1 [Selaginella moellendorffii] Length = 613 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMV PSTLLVLDEPTNHL+IPTKEMLE Sbjct: 476 CKFMVKPSTLLVLDEPTNHLDIPTKEMLE 504 >ref|XP_002988216.1| hypothetical protein SELMODRAFT_127481 [Selaginella moellendorffii] gi|300143948|gb|EFJ10635.1| hypothetical protein SELMODRAFT_127481 [Selaginella moellendorffii] Length = 613 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 5 CKFMVTPSTLLVLDEPTNHLNIPTKEMLE 91 CKFMV PSTLLVLDEPTNHL+IPTKEMLE Sbjct: 476 CKFMVKPSTLLVLDEPTNHLDIPTKEMLE 504