BLASTX nr result
ID: Mentha25_contig00030393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030393 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347731.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004230081.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 gb|EYU46233.1| hypothetical protein MIMGU_mgv1a019022mg [Mimulus... 68 2e-09 ref|XP_002320305.2| hypothetical protein POPTR_0014s11650g, part... 67 3e-09 gb|EYU34833.1| hypothetical protein MIMGU_mgv1a022327mg [Mimulus... 65 1e-08 ref|XP_002268129.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CAN78368.1| hypothetical protein VITISV_028672 [Vitis vinifera] 64 2e-08 ref|XP_006492325.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006444484.1| hypothetical protein CICLE_v10019225mg [Citr... 64 3e-08 gb|EXB53232.1| hypothetical protein L484_007175 [Morus notabilis] 63 5e-08 ref|XP_004144748.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 gb|AFW77725.1| ATP binding protein isoform 1 [Zea mays] gi|41394... 61 1e-07 ref|NP_001150456.1| LOC100284086 [Zea mays] gi|195639404|gb|ACG3... 61 1e-07 ref|XP_007014405.1| Pentatricopeptide repeat (PPR) superfamily p... 60 2e-07 ref|XP_003566348.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 gb|EYU20479.1| hypothetical protein MIMGU_mgv1a025024mg [Mimulus... 59 7e-07 ref|XP_006290311.1| hypothetical protein CARUB_v10019235mg [Caps... 58 1e-06 ref|XP_002515292.1| pentatricopeptide repeat-containing protein,... 58 2e-06 ref|XP_002878464.1| pentatricopeptide repeat-containing protein ... 57 2e-06 ref|NP_191806.1| pentatricopeptide repeat-containing protein [Ar... 57 3e-06 >ref|XP_006347731.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Solanum tuberosum] Length = 687 Score = 71.6 bits (174), Expect = 1e-10 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFS-GLRMNALDEYVEKARFSRNSEVASLF 178 GRS EA ++LEEMIDKGMKAPQLDY AA FS G R + L+E ++ +FS EV+SLF Sbjct: 611 GRSMEACKYLEEMIDKGMKAPQLDYNKFAADFSRGGRPDILEELAKRMKFSGKFEVSSLF 670 Query: 177 ANW 169 A W Sbjct: 671 ARW 673 >ref|XP_004230081.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Solanum lycopersicum] Length = 691 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/63 (58%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFS-GLRMNALDEYVEKARFSRNSEVASLF 178 GRS EA ++LEEMIDKGMKAPQLDY AA FS G + + L+E ++ +FS EV+SLF Sbjct: 615 GRSMEACKYLEEMIDKGMKAPQLDYNKFAADFSRGGKPDILEELAKRMKFSGKFEVSSLF 674 Query: 177 ANW 169 A W Sbjct: 675 ARW 677 >gb|EYU46233.1| hypothetical protein MIMGU_mgv1a019022mg [Mimulus guttatus] Length = 567 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAA--YFSGLRMNALDEYVEKARFSRNSEVASL 181 GR NE+ +LEEMIDKGM+AP++DYK +A Y+SG R N L++ EK + S NSEVA+L Sbjct: 503 GRLNESCRYLEEMIDKGMRAPRIDYKKFSAGFYWSGGR-NCLEDLAEKMKLSGNSEVANL 561 Query: 180 FANW 169 W Sbjct: 562 LERW 565 >ref|XP_002320305.2| hypothetical protein POPTR_0014s11650g, partial [Populus trichocarpa] gi|550324008|gb|EEE98620.2| hypothetical protein POPTR_0014s11650g, partial [Populus trichocarpa] Length = 614 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/63 (53%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GRS EA ++LEEMI+KGMKAPQLDY AA FS + + L+E +K +FS EV+++F Sbjct: 539 GRSEEACKYLEEMIEKGMKAPQLDYNKFAADFSRAGKPDILEELAQKMKFSGKFEVSNVF 598 Query: 177 ANW 169 A W Sbjct: 599 ARW 601 >gb|EYU34833.1| hypothetical protein MIMGU_mgv1a022327mg [Mimulus guttatus] Length = 370 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAA--YFSGLRMNALDEYVEKARFSRNSEVASL 181 GR NE+ +LE+MID GM+AP++DYKN +A Y SG R N L++ EK + S NSEVA+L Sbjct: 306 GRLNESCRYLEKMIDTGMRAPRIDYKNFSAGLYRSGGR-NCLEDLAEKMKLSGNSEVANL 364 Query: 180 FANW 169 W Sbjct: 365 LERW 368 >ref|XP_002268129.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Vitis vinifera] Length = 679 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GRS EA +LEEMI+KGMKAPQLDY AA FS + + L+E K +F EV+++F Sbjct: 596 GRSEEACRYLEEMIEKGMKAPQLDYNKFAADFSRAGKPDILEELARKMKFEGKFEVSNVF 655 Query: 177 ANW 169 A W Sbjct: 656 ARW 658 >emb|CAN78368.1| hypothetical protein VITISV_028672 [Vitis vinifera] Length = 927 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GRS EA +LEEMI+KGMKAPQLDY AA FS + + L+E K +F EV+++F Sbjct: 596 GRSEEACRYLEEMIEKGMKAPQLDYNKFAADFSRAGKPDILEELARKMKFEGKFEVSNVF 655 Query: 177 ANW 169 A W Sbjct: 656 ARW 658 >ref|XP_006492325.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Citrus sinensis] Length = 651 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = -3 Query: 351 RSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLFA 175 RS EAY++LEEM++KGMKAP LDY AA S R LDE +K RFS EV+++ A Sbjct: 573 RSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLA 632 Query: 174 NW 169 W Sbjct: 633 RW 634 >ref|XP_006444484.1| hypothetical protein CICLE_v10019225mg [Citrus clementina] gi|557546746|gb|ESR57724.1| hypothetical protein CICLE_v10019225mg [Citrus clementina] Length = 653 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = -3 Query: 351 RSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLFA 175 RS EAY++LEEM++KGMKAP LDY AA S R LDE +K RFS EV+++ A Sbjct: 575 RSGEAYKYLEEMLEKGMKAPVLDYNKFAADLSRAGRSYVLDELAQKMRFSGKFEVSNVLA 634 Query: 174 NW 169 W Sbjct: 635 RW 636 >gb|EXB53232.1| hypothetical protein L484_007175 [Morus notabilis] Length = 567 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GRS EA +++EEMI+KGMKAPQLDY AA FS + N L+E +K +F+ EV+++F Sbjct: 484 GRSGEACKYIEEMIEKGMKAPQLDYNKFAADFSRAGKPNILEELAQKMKFAGKFEVSNVF 543 Query: 177 A 175 A Sbjct: 544 A 544 >ref|XP_004144748.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] gi|449490811|ref|XP_004158714.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] Length = 621 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GR EA ++LEEMI+KGMKAPQLDY AA FS R + L+E +K +FS E +++ Sbjct: 536 GRCAEAGKYLEEMIEKGMKAPQLDYNKFAADFSRAGRPDILEELAQKMKFSGKFEASNVI 595 Query: 177 ANW 169 A W Sbjct: 596 ARW 598 >gb|AFW77725.1| ATP binding protein isoform 1 [Zea mays] gi|413945077|gb|AFW77726.1| ATP binding protein isoform 2 [Zea mays] gi|413945078|gb|AFW77727.1| ATP binding protein isoform 3 [Zea mays] Length = 634 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GR EAY+++EEMI+KGMKAPQ+DY AA FS + + L E +K +F+ +V+++F Sbjct: 556 GRPEEAYKYIEEMINKGMKAPQIDYNKFAADFSKAGKPDILFELAQKVKFAGKLDVSNVF 615 Query: 177 ANWPRR 160 W R Sbjct: 616 YQWADR 621 >ref|NP_001150456.1| LOC100284086 [Zea mays] gi|195639404|gb|ACG39170.1| ATP binding protein [Zea mays] Length = 634 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GR EAY+++EEMI+KGMKAPQ+DY AA FS + + L E +K +F+ +V+++F Sbjct: 556 GRPEEAYKYIEEMINKGMKAPQIDYNKFAADFSKAGKPDILFELAQKVKFAGKLDVSNVF 615 Query: 177 ANWPRR 160 W R Sbjct: 616 YQWADR 621 >ref|XP_007014405.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508784768|gb|EOY32024.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 627 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/63 (47%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GRS EA +FLEEM++KGMKAP LDY A FS + + L++ +K +FS E A++F Sbjct: 544 GRSGEACKFLEEMMEKGMKAPHLDYNKFGADFSRAGKPDKLEDLAQKMKFSGKFEAANVF 603 Query: 177 ANW 169 W Sbjct: 604 TRW 606 >ref|XP_003566348.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Brachypodium distachyon] Length = 649 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFSGL-RMNALDEYVEKARFSRNSEVASLF 178 GR EA +FLEEMI KGMKAPQ+DY AA FS + + L E +K +F+ +V+++F Sbjct: 566 GRPAEACKFLEEMIQKGMKAPQIDYNKFAADFSKAGKPDILYELAQKVKFTGKFDVSNVF 625 Query: 177 ANWPRR 160 W R Sbjct: 626 HQWAER 631 >gb|EYU20479.1| hypothetical protein MIMGU_mgv1a025024mg [Mimulus guttatus] Length = 190 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/62 (46%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAA-YFSGLRMNALDEYVEKARFSRNSEVASLF 178 GR NE+ +LE+MIDK M+APQ+DYK ++ ++ N L++ EK + S NSEVA+L Sbjct: 101 GRLNESCRYLEKMIDKRMRAPQIDYKKFSSGFYWSCGRNCLEDLAEKMKLSGNSEVANLL 160 Query: 177 AN 172 N Sbjct: 161 EN 162 >ref|XP_006290311.1| hypothetical protein CARUB_v10019235mg [Capsella rubella] gi|482559018|gb|EOA23209.1| hypothetical protein CARUB_v10019235mg [Capsella rubella] Length = 597 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAA-YFSGLRMNALDEYVEKARFSRNSEVASLF 178 G+S EA +LEEM+DKGMK P +DY AA ++ G + +E ++A+FS A +F Sbjct: 520 GKSREACRYLEEMLDKGMKTPLIDYNKFAADFYRGGQPEIFEELAQRAKFSGKFAAAEIF 579 Query: 177 ANW 169 A W Sbjct: 580 ARW 582 >ref|XP_002515292.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545772|gb|EEF47276.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 533 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/63 (46%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYFS-GLRMNALDEYVEKARFSRNSEVASLF 178 GRS EA ++LEEM++KGMKAPQLDY A S G + L+E ++ +FS V+++ Sbjct: 456 GRSGEACKYLEEMLEKGMKAPQLDYNKFGADLSRGGNPDILEELAQRLKFSGKFGVSNVL 515 Query: 177 ANW 169 A+W Sbjct: 516 ASW 518 >ref|XP_002878464.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324302|gb|EFH54723.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 628 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYF-SGLRMNALDEYVEKARFSRNSEVASLF 178 G+S EA +LEEM+DKGMK P +DY AA F G + +E ++A+FS A +F Sbjct: 531 GKSREACRYLEEMLDKGMKTPLIDYNKFAADFHKGGQPEIFEELAQRAKFSGKFAAAEIF 590 Query: 177 ANW 169 A W Sbjct: 591 ARW 593 >ref|NP_191806.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181319|sp|Q9LZP3.1|PP293_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g62470, mitochondrial; Flags: Precursor gi|7340718|emb|CAB82961.1| putative protein [Arabidopsis thaliana] gi|34365579|gb|AAQ65101.1| At3g62470 [Arabidopsis thaliana] gi|332646835|gb|AEE80356.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 599 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -3 Query: 354 GRSNEAYEFLEEMIDKGMKAPQLDYKNIAAYF-SGLRMNALDEYVEKARFSRNSEVASLF 178 G+S EA +LEEM+DKGMK P +DY AA F G + +E ++A+FS A +F Sbjct: 522 GKSREACRYLEEMLDKGMKTPLIDYNKFAADFHRGGQPEIFEELAQRAKFSGKFAAAEIF 581 Query: 177 ANW 169 A W Sbjct: 582 ARW 584