BLASTX nr result
ID: Mentha25_contig00029952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029952 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20159.1| hypothetical protein MIMGU_mgv1a004489mg [Mimulus... 74 2e-11 ref|XP_007038226.1| Mitochondrial import inner membrane transloc... 62 1e-07 ref|XP_007218998.1| hypothetical protein PRUPE_ppa004102mg [Prun... 61 2e-07 ref|XP_002511035.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 ref|XP_004309011.1| PREDICTED: uncharacterized protein LOC101297... 60 3e-07 ref|XP_002321783.1| hypothetical protein POPTR_0015s12270g [Popu... 59 7e-07 ref|XP_002318431.2| hypothetical protein POPTR_0012s02340g [Popu... 59 9e-07 ref|XP_006376954.1| hypothetical protein POPTR_0012s11520g [Popu... 59 9e-07 ref|XP_004495244.1| PREDICTED: uncharacterized protein LOC101490... 57 2e-06 ref|NP_199928.1| mitochondrial import inner membrane translocase... 57 2e-06 ref|XP_006485030.1| PREDICTED: uncharacterized protein LOC102609... 57 3e-06 ref|XP_006280292.1| hypothetical protein CARUB_v10026216mg [Caps... 57 3e-06 gb|EPS58646.1| hypothetical protein M569_16167, partial [Genlise... 56 6e-06 >gb|EYU20159.1| hypothetical protein MIMGU_mgv1a004489mg [Mimulus guttatus] Length = 525 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 RSASY+YLQTLDAMKKP+V D RENET++SEKYNLESIPGL Sbjct: 485 RSASYTYLQTLDAMKKPDVQDNRENETSNSEKYNLESIPGL 525 >ref|XP_007038226.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein isoform 1 [Theobroma cacao] gi|508775471|gb|EOY22727.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein isoform 1 [Theobroma cacao] Length = 521 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R+ASY+YLQTLDAM KP++ D RE ET++ ++YNLESIPGL Sbjct: 481 RTASYTYLQTLDAMNKPQLQDNREVETSTPKQYNLESIPGL 521 >ref|XP_007218998.1| hypothetical protein PRUPE_ppa004102mg [Prunus persica] gi|462415460|gb|EMJ20197.1| hypothetical protein PRUPE_ppa004102mg [Prunus persica] Length = 530 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 RS+SY+YLQ+LDAMKKP++LD R E + SEKYNLESIPGL Sbjct: 491 RSSSYTYLQSLDAMKKPKLLDSRRTE-SPSEKYNLESIPGL 530 >ref|XP_002511035.1| conserved hypothetical protein [Ricinus communis] gi|223550150|gb|EEF51637.1| conserved hypothetical protein [Ricinus communis] Length = 525 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R+ASY+YLQ LDAMK P++ + RE E +SS+KYNLESIPGL Sbjct: 485 RTASYTYLQALDAMKPPKLQESREAEASSSQKYNLESIPGL 525 >ref|XP_004309011.1| PREDICTED: uncharacterized protein LOC101297890 [Fragaria vesca subsp. vesca] Length = 521 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R+ASYSYLQTLDAMKKP++L+ +E S +KYNLESIPGL Sbjct: 481 RNASYSYLQTLDAMKKPKLLEGDGSEGPSEKKYNLESIPGL 521 >ref|XP_002321783.1| hypothetical protein POPTR_0015s12270g [Populus trichocarpa] gi|222868779|gb|EEF05910.1| hypothetical protein POPTR_0015s12270g [Populus trichocarpa] Length = 521 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 RSASY+YLQTLDA+KKP++ + RE E ++S++YNLESI GL Sbjct: 481 RSASYTYLQTLDAIKKPKLQESREAEASTSQEYNLESIEGL 521 >ref|XP_002318431.2| hypothetical protein POPTR_0012s02340g [Populus trichocarpa] gi|550326213|gb|EEE96651.2| hypothetical protein POPTR_0012s02340g [Populus trichocarpa] Length = 66 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R SY+YLQTLDA+KKP+ + RE+E + S+KYNLESIPGL Sbjct: 26 RVPSYTYLQTLDAIKKPKSQESREDEASPSQKYNLESIPGL 66 >ref|XP_006376954.1| hypothetical protein POPTR_0012s11520g [Populus trichocarpa] gi|550326889|gb|ERP54751.1| hypothetical protein POPTR_0012s11520g [Populus trichocarpa] Length = 521 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R SY+YLQTLDA+KKP+ + RE+E + S+KYNLESIPGL Sbjct: 481 RVPSYTYLQTLDAIKKPKSQESREDEASPSQKYNLESIPGL 521 >ref|XP_004495244.1| PREDICTED: uncharacterized protein LOC101490039 [Cicer arietinum] Length = 529 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 R+ SY+YLQ LD + KP + ++R+ E++SSEKYNLESIPGL Sbjct: 489 RTTSYTYLQALDGVTKPTLQERRDTESSSSEKYNLESIPGL 529 >ref|NP_199928.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] gi|8843851|dbj|BAA97377.1| unnamed protein product [Arabidopsis thaliana] gi|15027963|gb|AAK76512.1| unknown protein [Arabidopsis thaliana] gi|20259195|gb|AAM14313.1| unknown protein [Arabidopsis thaliana] gi|332008661|gb|AED96044.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] Length = 531 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 6 SASYSYLQTLDAMKKPEVLDKRENET-TSSEKYNLESIPGL 125 S+SYSYLQTLDA+KKP+ + RE ET + EKYNLE+IPGL Sbjct: 491 SSSYSYLQTLDALKKPKTQESREGETPKAEEKYNLEAIPGL 531 >ref|XP_006485030.1| PREDICTED: uncharacterized protein LOC102609314 [Citrus sinensis] Length = 519 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTSSEKYNLESIPGL 125 RSASY+YLQTLDAM KP++ + ++ E++SSEK NLESI GL Sbjct: 479 RSASYTYLQTLDAMNKPKLEESKQAESSSSEKLNLESISGL 519 >ref|XP_006280292.1| hypothetical protein CARUB_v10026216mg [Capsella rubella] gi|482548996|gb|EOA13190.1| hypothetical protein CARUB_v10026216mg [Capsella rubella] Length = 531 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENET-TSSEKYNLESIPGL 125 R++SY+YLQTLDA+KKP+ + RE ET + EKYNLE+IPGL Sbjct: 490 RNSSYTYLQTLDALKKPKTQESREGETPKAEEKYNLEAIPGL 531 >gb|EPS58646.1| hypothetical protein M569_16167, partial [Genlisea aurea] Length = 515 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/42 (64%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 3 RSASYSYLQTLDAMKKPEVLDKRENETTS-SEKYNLESIPGL 125 RSAS++YLQTLDAMKKP+ ++ +++ + SEKYNLESIPGL Sbjct: 474 RSASFAYLQTLDAMKKPDEEEEEDDDANNKSEKYNLESIPGL 515