BLASTX nr result
ID: Mentha25_contig00029938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029938 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276573.2| PREDICTED: uncharacterized protein LOC100253... 65 1e-08 emb|CAN67151.1| hypothetical protein VITISV_019728 [Vitis vinifera] 59 9e-07 >ref|XP_002276573.2| PREDICTED: uncharacterized protein LOC100253614 [Vitis vinifera] Length = 641 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = +1 Query: 157 IWMDACELEKALGKQSSAVNLRPPLVSADNKNGATRRSKTREVSSRYMSP 306 +WMD CE EKAL K ++ R PLV A+ NG TRR KTREVSSRY SP Sbjct: 2 VWMDVCEAEKALQKHTAVETSRRPLVPAEKCNGVTRRPKTREVSSRYKSP 51 >emb|CAN67151.1| hypothetical protein VITISV_019728 [Vitis vinifera] Length = 610 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +1 Query: 163 MDACELEKALGKQSSAVNLRPPLVSADNKNGATRRSKTREVSSRYMSP 306 MD CE EKAL K ++ R PLV A+ NG TRR KT+EVSSRY SP Sbjct: 1 MDVCEAEKALQKHTAVETSRRPLVPAEKCNGVTRRPKTKEVSSRYKSP 48