BLASTX nr result
ID: Mentha25_contig00029669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029669 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctiona... 66 4e-09 ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctiona... 64 3e-08 ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctiona... 61 1e-07 >ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Solanum lycopersicum] Length = 470 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = -3 Query: 197 MALYISHHITTLKFPGLNQSKITSSASRLRMDSCRVFAAVSVGEDVSKYIPAAPILLPEG 18 MAL + H I+ +F LN K+ S R D C+VF +S+ ++ S YIPAAPI LPEG Sbjct: 1 MALSVPHFISVSRFSDLNGVKVRGSPRCFRRD-CKVFTVISMSKEASNYIPAAPIFLPEG 59 Query: 17 PWHQV 3 PW Q+ Sbjct: 60 PWQQI 64 >ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 470 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = -3 Query: 197 MALYISHHITTLKFPGLNQSKITSSASRLRMDSCRVFAAVSVGEDVSKYIPAAPILLPEG 18 M+L + H I+ +F LN K+ S + D C+VF +S+ ++ S YIPAAPI LPEG Sbjct: 1 MSLSVPHFISVSRFSDLNGVKVRGSPRCFQRD-CKVFTVISMSKEASNYIPAAPIFLPEG 59 Query: 17 PWHQV 3 PW Q+ Sbjct: 60 PWQQI 64 >ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 472 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -3 Query: 197 MALYISHHITTLKFPGLNQSKITSSAS-RLRMDSCRVFAAVSVGEDVSKYIPAAPILLPE 21 M+L + H I+ +F LN K+ S R C+VF +S+ ++ S YIPAAPI LPE Sbjct: 1 MSLSVPHFISVSRFSDLNGVKLQVRGSPRCFQRDCKVFTVISMSKEASNYIPAAPIFLPE 60 Query: 20 GPWHQV 3 GPW Q+ Sbjct: 61 GPWQQI 66