BLASTX nr result
ID: Mentha25_contig00029606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029606 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60692.1| hypothetical protein M569_14112 [Genlisea aurea] 69 5e-10 gb|EYU43654.1| hypothetical protein MIMGU_mgv1a014274mg [Mimulus... 68 1e-09 ref|XP_006365059.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 68 2e-09 ref|XP_004233258.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 67 3e-09 ref|XP_004233257.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 67 3e-09 ref|XP_004233256.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 67 3e-09 emb|CBI27208.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vi... 65 1e-08 ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] g... 62 8e-08 ref|XP_002879529.1| hypothetical protein ARALYDRAFT_482466 [Arab... 59 7e-07 emb|CAN74552.1| hypothetical protein VITISV_019041 [Vitis vinifera] 59 7e-07 gb|EXB56422.1| Thioredoxin O1 [Morus notabilis] 59 9e-07 dbj|BAC43652.1| putative thioredoxin [Arabidopsis thaliana] 58 2e-06 ref|NP_181046.1| thioredoxin O1 [Arabidopsis thaliana] gi|145330... 58 2e-06 ref|XP_006295027.1| hypothetical protein CARUB_v10024096mg [Caps... 57 4e-06 ref|XP_006468538.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 56 6e-06 ref|XP_006448638.1| hypothetical protein CICLE_v10016549mg [Citr... 56 6e-06 ref|XP_004293783.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 56 6e-06 >gb|EPS60692.1| hypothetical protein M569_14112 [Genlisea aurea] Length = 177 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+HSVPTL FF NGKKA EV+GADV+R+KETME+LYK Sbjct: 138 SKLNIHSVPTLQFFHNGKKASEVVGADVQRVKETMESLYK 177 >gb|EYU43654.1| hypothetical protein MIMGU_mgv1a014274mg [Mimulus guttatus] Length = 195 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK ++ SVPTLHFFQNGKKA EV+GADVE +K+TMETLYK Sbjct: 156 SKLDIRSVPTLHFFQNGKKASEVVGADVELVKDTMETLYK 195 >ref|XP_006365059.1| PREDICTED: thioredoxin O1, mitochondrial-like [Solanum tuberosum] Length = 194 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPTLHF+QNGKK EVIGADV+RLKETME LYK Sbjct: 155 SKLNISAVPTLHFYQNGKKTSEVIGADVQRLKETMEELYK 194 >ref|XP_004233258.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 3 [Solanum lycopersicum] Length = 172 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ SVPTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 133 SKLNITSVPTLHFFQNGKKTSEVIGADVQLLKETMEELYK 172 >ref|XP_004233257.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 189 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ SVPTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 150 SKLNITSVPTLHFFQNGKKTSEVIGADVQLLKETMEELYK 189 >ref|XP_004233256.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 194 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ SVPTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 155 SKLNITSVPTLHFFQNGKKTSEVIGADVQLLKETMEELYK 194 >emb|CBI27208.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 349 NVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 N+ SVPTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 170 NIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 206 >ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vitis vinifera] gi|359473079|ref|XP_003631244.1| PREDICTED: thioredoxin O1, mitochondrial-like [Vitis vinifera] gi|297738008|emb|CBI27209.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 349 NVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 N+ SVPTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 148 NIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 184 >ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] gi|223525268|gb|EEF27933.1| Thioredoxin I, putative [Ricinus communis] Length = 206 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 346 VHSVPTLHFFQNGKKAGEVIGADVERLKETMETLY 242 + +VPTLHFFQNGKKA E++GADVER+K+TME LY Sbjct: 169 ISAVPTLHFFQNGKKAAEIVGADVERIKDTMEELY 203 >ref|XP_002879529.1| hypothetical protein ARALYDRAFT_482466 [Arabidopsis lyrata subsp. lyrata] gi|297325368|gb|EFH55788.1| hypothetical protein ARALYDRAFT_482466 [Arabidopsis lyrata subsp. lyrata] Length = 194 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ SVPTLHFF+ G K GEV+GADV +LK ME LYK Sbjct: 155 SKLNITSVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 194 >emb|CAN74552.1| hypothetical protein VITISV_019041 [Vitis vinifera] Length = 152 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 334 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 PTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 121 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 152 >gb|EXB56422.1| Thioredoxin O1 [Morus notabilis] Length = 260 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 S+ N+ SVPT HFFQNGKKA EVIGAD LK TME LYK Sbjct: 116 SELNITSVPTFHFFQNGKKAAEVIGADGGLLKGTMEKLYK 155 >dbj|BAC43652.1| putative thioredoxin [Arabidopsis thaliana] Length = 96 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPTLHFF+ G K GEV+GADV +LK ME LYK Sbjct: 57 SKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 96 >ref|NP_181046.1| thioredoxin O1 [Arabidopsis thaliana] gi|145330362|ref|NP_001078006.1| thioredoxin O1 [Arabidopsis thaliana] gi|75099186|sp|O64764.1|TRXO1_ARATH RecName: Full=Thioredoxin O1, mitochondrial; Short=AtTrxo1; Flags: Precursor gi|3033396|gb|AAC12840.1| putative thioredoxin [Arabidopsis thaliana] gi|107738216|gb|ABF83663.1| At2g35010 [Arabidopsis thaliana] gi|330253954|gb|AEC09048.1| thioredoxin O1 [Arabidopsis thaliana] gi|330253955|gb|AEC09049.1| thioredoxin O1 [Arabidopsis thaliana] Length = 194 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPTLHFF+ G K GEV+GADV +LK ME LYK Sbjct: 155 SKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLYK 194 >ref|XP_006295027.1| hypothetical protein CARUB_v10024096mg [Capsella rubella] gi|482563735|gb|EOA27925.1| hypothetical protein CARUB_v10024096mg [Capsella rubella] Length = 198 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPTLHFF+ G K GE++GADV +LK ME LYK Sbjct: 159 SKLNIAAVPTLHFFKGGLKKGEIVGADVTKLKNLMEQLYK 198 >ref|XP_006468538.1| PREDICTED: thioredoxin O1, mitochondrial-like [Citrus sinensis] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPT FFQ+G+K E++GADV RLK TME LYK Sbjct: 150 SKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYK 189 >ref|XP_006448638.1| hypothetical protein CICLE_v10016549mg [Citrus clementina] gi|567912651|ref|XP_006448639.1| hypothetical protein CICLE_v10016549mg [Citrus clementina] gi|557551249|gb|ESR61878.1| hypothetical protein CICLE_v10016549mg [Citrus clementina] gi|557551250|gb|ESR61879.1| hypothetical protein CICLE_v10016549mg [Citrus clementina] Length = 229 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 358 SKSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 SK N+ +VPT FFQ+G+K E++GADV RLK TME LYK Sbjct: 188 SKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYK 227 >ref|XP_004293783.1| PREDICTED: thioredoxin O1, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 200 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 355 KSNVHSVPTLHFFQNGKKAGEVIGADVERLKETMETLYK 239 K N+ SVPT HFFQNG+KA E +GAD RLK+T LYK Sbjct: 159 KLNISSVPTFHFFQNGEKADEFVGADATRLKDTYAKLYK 197