BLASTX nr result
ID: Mentha25_contig00029379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029379 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC19362.1| hypothetical protein L484_010379 [Morus notabilis] 57 4e-06 ref|XP_007009155.1| Uncharacterized protein isoform 1 [Theobroma... 56 6e-06 >gb|EXC19362.1| hypothetical protein L484_010379 [Morus notabilis] Length = 161 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -1 Query: 433 RTSEPDTDNQHKKDGGVDDSSGTNSTGASRGNWWEGSLYY 314 RT ++ + KKDG DD +G NS ASRGNWW+GSLYY Sbjct: 122 RTRTTESQHSFKKDGSEDDPNGNNSNSASRGNWWQGSLYY 161 >ref|XP_007009155.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590562689|ref|XP_007009156.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508726068|gb|EOY17965.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508726069|gb|EOY17966.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 175 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 430 TSEPDTDNQHKKDGGVDDSSGTNSTGASRGNWWEGSLYY 314 T+EP + KKDG DD +G NS+GASRGNWW+GSLYY Sbjct: 139 TNEPQ--HYFKKDGEDDDPNGNNSSGASRGNWWQGSLYY 175