BLASTX nr result
ID: Mentha25_contig00028881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00028881 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus] 94 6e-36 gb|ABK94763.1| unknown [Populus trichocarpa] 91 3e-35 ref|XP_002305951.2| mangrin family protein [Populus trichocarpa]... 91 3e-35 gb|EYU44656.1| hypothetical protein MIMGU_mgv1a012403mg [Mimulus... 93 4e-35 gb|ABK96763.1| unknown [Populus trichocarpa x Populus deltoides] 91 4e-35 ref|XP_006482294.1| PREDICTED: allene oxide cyclase 4, chloropla... 91 9e-35 ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prun... 86 2e-34 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] 87 2e-34 emb|CBI16856.3| unnamed protein product [Vitis vinifera] 90 2e-34 ref|XP_006430815.1| hypothetical protein CICLE_v10012552mg [Citr... 91 3e-34 gb|ACD12705.1| AOC [Petunia x hybrida] 90 3e-34 gb|AFB69864.1| allene oxide cyclase [Salvia miltiorrhiza] gi|377... 90 4e-34 gb|AAX56078.1| allene oxide cyclase [Camptotheca acuminata] 89 7e-34 emb|CAC83765.1| allene oxide cyclase [Nicotiana tabacum] 89 7e-34 ref|NP_001234019.1| allene oxide cyclase [Solanum lycopersicum] ... 90 7e-34 gb|AAA80500.1| unknown, partial [Solanum lycopersicum] 90 7e-34 gb|ACZ06580.1| allene oxide cyclase [Jatropha curcas] 88 9e-34 ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prun... 86 9e-34 ref|XP_004297139.1| PREDICTED: allene oxide cyclase 3, chloropla... 86 1e-33 ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]... 86 2e-33 >gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus] Length = 251 Score = 94.4 bits (233), Expect(2) = 6e-36 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 309 SDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 SDS+STK+QELHVYEINERDRGSPAYLRLSQKT NSLGDLVPF+NKVY+ Sbjct: 73 SDSRSTKIQELHVYEINERDRGSPAYLRLSQKTANSLGDLVPFTNKVYS 121 Score = 82.4 bits (202), Expect(2) = 6e-36 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG YLTYEDT LAVTGGSGIFEGV Sbjct: 149 YEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGV 189 >gb|ABK94763.1| unknown [Populus trichocarpa] Length = 251 Score = 91.3 bits (225), Expect(2) = 3e-35 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 T DS+ TKVQEL VYEINERDRGSPAYLRLSQK+VNSLGDLVPFSNK+YT Sbjct: 71 TEDSRPTKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYT 120 Score = 83.2 bits (204), Expect(2) = 3e-35 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG+YLTYEDT LAVTGGSGIFEGV Sbjct: 148 YEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFEGV 188 >ref|XP_002305951.2| mangrin family protein [Populus trichocarpa] gi|118484502|gb|ABK94126.1| unknown [Populus trichocarpa] gi|550340728|gb|EEE86462.2| mangrin family protein [Populus trichocarpa] Length = 251 Score = 91.3 bits (225), Expect(2) = 3e-35 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 T DS+ TKVQEL VYEINERDRGSPAYLRLSQK+VNSLGDLVPFSNK+YT Sbjct: 71 TEDSRPTKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYT 120 Score = 83.2 bits (204), Expect(2) = 3e-35 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG+YLTYEDT LAVTGGSGIFEGV Sbjct: 148 YEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFEGV 188 >gb|EYU44656.1| hypothetical protein MIMGU_mgv1a012403mg [Mimulus guttatus] Length = 251 Score = 93.2 bits (230), Expect(2) = 4e-35 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -1 Query: 309 SDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 SD++S+K+QEL+VYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT Sbjct: 73 SDTRSSKIQELNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 121 Score = 80.9 bits (198), Expect(2) = 4e-35 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEG 6 YEAIYSFYFGDYGHI+VQG YLTYEDT LAVTGGSGIFEG Sbjct: 149 YEAIYSFYFGDYGHIAVQGPYLTYEDTCLAVTGGSGIFEG 188 >gb|ABK96763.1| unknown [Populus trichocarpa x Populus deltoides] Length = 251 Score = 90.9 bits (224), Expect(2) = 4e-35 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 T DS+ TKVQEL VYEINERDRGSPAYLRLSQK VNSLGDLVPFSNK+YT Sbjct: 71 TEDSRPTKVQELSVYEINERDRGSPAYLRLSQKAVNSLGDLVPFSNKLYT 120 Score = 83.2 bits (204), Expect(2) = 4e-35 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG+YLTYEDT LAVTGGSGIFEGV Sbjct: 148 YEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFEGV 188 >ref|XP_006482294.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus sinensis] Length = 251 Score = 90.5 bits (223), Expect(2) = 9e-35 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 + D + TKVQELHVYEINERDRGSPAYLRLSQK VNSLGDLVPFSNK+YT Sbjct: 72 SDDPRPTKVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYT 121 Score = 82.4 bits (202), Expect(2) = 9e-35 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG YLTYEDT LAVTGGSGIFEGV Sbjct: 149 YEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGV 189 >ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] gi|462420656|gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica] Length = 251 Score = 86.3 bits (212), Expect(2) = 2e-34 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 303 SKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 S+ TKVQELHVYEINERDRGSPAYLRLS+K VNSLGDLVPF+NK+Y+ Sbjct: 74 SRPTKVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFTNKIYS 120 Score = 85.5 bits (210), Expect(2) = 2e-34 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHISVQGAYLTYEDT LAVTGGSGIFEGV Sbjct: 148 YEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGV 188 >gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] Length = 247 Score = 87.4 bits (215), Expect(2) = 2e-34 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 309 SDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 S+ TKVQEL+VYEINERDRGSPAYLRLSQK+VNSLGDLVPFSNK+YT Sbjct: 69 SERPPTKVQELYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYT 117 Score = 84.3 bits (207), Expect(2) = 2e-34 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHISVQG+YLTYEDT LAVTGGSGIFEGV Sbjct: 145 YEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTGGSGIFEGV 185 >emb|CBI16856.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 89.7 bits (221), Expect(2) = 2e-34 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 300 KSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 + TKVQELHVYEINERDRGSPAYLRLSQK+VNSLGDLVPFSNK+YT Sbjct: 76 RPTKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYT 121 Score = 81.6 bits (200), Expect(2) = 2e-34 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEG 6 YEA YSFYFGDYGHISVQGAYLTYEDT LA+TGGSGIFEG Sbjct: 149 YEATYSFYFGDYGHISVQGAYLTYEDTYLAITGGSGIFEG 188 >ref|XP_006430815.1| hypothetical protein CICLE_v10012552mg [Citrus clementina] gi|557532872|gb|ESR44055.1| hypothetical protein CICLE_v10012552mg [Citrus clementina] Length = 251 Score = 90.5 bits (223), Expect(2) = 3e-34 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 + D + TKVQELHVYEINERDRGSPAYLRLSQK VNSLGDLVPFSNK+YT Sbjct: 72 SDDPRPTKVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYT 121 Score = 80.5 bits (197), Expect(2) = 3e-34 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEA YSFYFGDYGHI+VQG YLTYEDT LAVTGGSGIFEGV Sbjct: 149 YEATYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGV 189 >gb|ACD12705.1| AOC [Petunia x hybrida] Length = 243 Score = 90.1 bits (222), Expect(2) = 3e-34 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 ++DS +TKVQEL VYE+NERDRGSPAYLRLSQKTVNSLGDLVPFSNK+YT Sbjct: 64 STDSTNTKVQELSVYEMNERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYT 113 Score = 80.9 bits (198), Expect(2) = 3e-34 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG+YLTYEDT LAVTGGSGIF GV Sbjct: 141 YEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFAGV 181 >gb|AFB69864.1| allene oxide cyclase [Salvia miltiorrhiza] gi|377552571|gb|AFB69865.1| allene oxide cyclase [Salvia miltiorrhiza] Length = 239 Score = 90.1 bits (222), Expect(2) = 4e-34 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -1 Query: 309 SDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 S + KVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT Sbjct: 61 STPRPQKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 109 Score = 80.5 bits (197), Expect(2) = 4e-34 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFY GDYGHI+VQG YLTY+DT+LAVTGGSG+FEGV Sbjct: 137 YEAIYSFYLGDYGHIAVQGPYLTYQDTELAVTGGSGVFEGV 177 >gb|AAX56078.1| allene oxide cyclase [Camptotheca acuminata] Length = 246 Score = 88.6 bits (218), Expect(2) = 7e-34 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 + S+ +KVQELHVYEINERDRGSPAYLRLSQK+VNSLGDLVPFSNK+Y+ Sbjct: 67 SDSSRPSKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYS 116 Score = 81.3 bits (199), Expect(2) = 7e-34 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQGAYLT++DT LAVTGGSGIFEGV Sbjct: 144 YEAIYSFYFGDYGHIAVQGAYLTHQDTYLAVTGGSGIFEGV 184 >emb|CAC83765.1| allene oxide cyclase [Nicotiana tabacum] Length = 245 Score = 89.0 bits (219), Expect(2) = 7e-34 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 ++DS +TKVQEL VYE+NERDRGSPAYLRLSQK VNSLGDLVPFSNK+YT Sbjct: 66 STDSSTTKVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYT 115 Score = 80.9 bits (198), Expect(2) = 7e-34 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQG+YLTYEDT LAVTGGSGIF GV Sbjct: 143 YEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFAGV 183 >ref|NP_001234019.1| allene oxide cyclase [Solanum lycopersicum] gi|14423351|gb|AAK62358.1|AF384374_1 allene oxide cylase [Solanum lycopersicum] gi|8977961|emb|CAB95731.1| allene oxide cyclase [Solanum lycopersicum] gi|40643243|emb|CAC83759.1| allene oxide cyclase [Solanum lycopersicum] gi|40643245|emb|CAC83760.1| allene oxide cyclase [Solanum lycopersicum] Length = 244 Score = 89.7 bits (221), Expect(2) = 7e-34 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 ++DS +T+VQEL VYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNK+YT Sbjct: 65 STDSTNTEVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYT 114 Score = 80.1 bits (196), Expect(2) = 7e-34 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEA+YSFYFGDYGHI+VQGAYLTYE+T LAVTGGSGIF GV Sbjct: 142 YEAVYSFYFGDYGHIAVQGAYLTYEETYLAVTGGSGIFAGV 182 >gb|AAA80500.1| unknown, partial [Solanum lycopersicum] Length = 214 Score = 89.7 bits (221), Expect(2) = 7e-34 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 ++DS +T+VQEL VYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNK+YT Sbjct: 35 STDSTNTEVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYT 84 Score = 80.1 bits (196), Expect(2) = 7e-34 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEA+YSFYFGDYGHI+VQGAYLTYE+T LAVTGGSGIF GV Sbjct: 112 YEAVYSFYFGDYGHIAVQGAYLTYEETYLAVTGGSGIFAGV 152 >gb|ACZ06580.1| allene oxide cyclase [Jatropha curcas] Length = 250 Score = 87.8 bits (216), Expect(2) = 9e-34 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 + DS +K QELHVYEINERDRGSPAYLRLSQK VNSLGDLVPFSNK+YT Sbjct: 71 SDDSTPSKFQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYT 120 Score = 81.6 bits (200), Expect(2) = 9e-34 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHI+VQGAYLTYED+ LAVTGG+GIFEGV Sbjct: 148 YEAIYSFYFGDYGHIAVQGAYLTYEDSYLAVTGGTGIFEGV 188 >ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] gi|462411191|gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] Length = 184 Score = 85.9 bits (211), Expect(2) = 9e-34 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 312 TSDSKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 +S S+ TKVQELHVYEINERDR SPAYL LSQK VNSLGDLVPF+NK+YT Sbjct: 4 SSASRPTKVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYT 53 Score = 83.6 bits (205), Expect(2) = 9e-34 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHISVQG YLTYEDT LAVTGGSGIFEGV Sbjct: 81 YEAIYSFYFGDYGHISVQGPYLTYEDTYLAVTGGSGIFEGV 121 >ref|XP_004297139.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 250 Score = 85.5 bits (210), Expect(2) = 1e-33 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEGV 3 YEAIYSFYFGDYGHISVQGAYLTYEDT LAVTGGSGIFEGV Sbjct: 148 YEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGV 188 Score = 83.6 bits (205), Expect(2) = 1e-33 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 303 SKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 ++ TKVQEL+VYEINERDRGSPAYLRLS+K VNSLGDLVPFSNK+Y+ Sbjct: 74 TRPTKVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYS 120 >ref|NP_001240200.1| membrane primary amine oxidase [Glycine max] gi|332739618|gb|AEE99198.1| allene oxide cyclase 3 [Glycine max] Length = 257 Score = 85.9 bits (211), Expect(2) = 2e-33 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 303 SKSTKVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT 163 S S KVQEL VYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNK+Y+ Sbjct: 81 SDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYS 127 Score = 82.8 bits (203), Expect(2) = 2e-33 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 125 YEAIYSFYFGDYGHISVQGAYLTYEDTDLAVTGGSGIFEG 6 YEAIYSFYFGDYGHISVQG+YLTYEDT LAVTGGSGIFEG Sbjct: 155 YEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTGGSGIFEG 194