BLASTX nr result
ID: Mentha25_contig00028755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00028755 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46765.1| hypothetical protein MIMGU_mgv1a007648mg [Mimulus... 60 2e-07 >gb|EYU46765.1| hypothetical protein MIMGU_mgv1a007648mg [Mimulus guttatus] Length = 400 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/66 (48%), Positives = 35/66 (53%) Frame = +1 Query: 157 MDTDFEEGKLKSLHISSLSXXXXXXXXXXXXXXXXXXXXXXQIPMTLGFAEKPKNPWSSR 336 MD D E KL+SLHISSL ++PMTLGFAEKPK PWS Sbjct: 1 MDIDENENKLRSLHISSLDEEEDEDDDVEDELTDEDDDEEDRVPMTLGFAEKPKYPWSLL 60 Query: 337 RQYFPS 354 QYFPS Sbjct: 61 PQYFPS 66