BLASTX nr result
ID: Mentha25_contig00028704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00028704 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22618.1| hypothetical protein MIMGU_mgv1a024305mg, partial... 74 2e-11 >gb|EYU22618.1| hypothetical protein MIMGU_mgv1a024305mg, partial [Mimulus guttatus] Length = 164 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/63 (58%), Positives = 40/63 (63%) Frame = +1 Query: 142 MCXXXXXXXLCFPSKAPLSSHNRFNFIFHGSPFTIRRRNPSHIALSASIAEKNSSLEFSW 321 MC L FPSK RFNF F G+P IR RNPSH +SASIAEKNS LEFSW Sbjct: 1 MCSSISSFSLFFPSKTHTLLRRRFNFSFSGNPLHIRPRNPSHFPISASIAEKNSGLEFSW 60 Query: 322 ISS 330 +SS Sbjct: 61 VSS 63