BLASTX nr result
ID: Mentha25_contig00027810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00027810 (1351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19859.1| hypothetical protein MIMGU_mgv1a001139mg [Mimulus... 60 2e-06 gb|EYU33150.1| hypothetical protein MIMGU_mgv1a003975mg [Mimulus... 60 3e-06 >gb|EYU19859.1| hypothetical protein MIMGU_mgv1a001139mg [Mimulus guttatus] Length = 879 Score = 60.1 bits (144), Expect = 2e-06 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 1014 GNNFQMNGEDSMAEDPVQSTAPTPSLPVFGQANASPSPSGFMFGST 1151 G+N +M+ EDSMAEDPVQ +A PS+ VFGQ + SPSP GF FGST Sbjct: 775 GSNDRMSAEDSMAEDPVQQSA--PSVSVFGQPSLSPSPPGFTFGST 818 >gb|EYU33150.1| hypothetical protein MIMGU_mgv1a003975mg [Mimulus guttatus] Length = 551 Score = 59.7 bits (143), Expect = 3e-06 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 1017 NNFQMNGEDSMAEDPVQSTAPT-PSL-PVFGQANASPSPSGFMFGST 1151 NN QM+ EDSMAED VQSTAP+ P+ FGQ SPSP+GFMFGST Sbjct: 436 NNDQMSAEDSMAEDTVQSTAPSVPAFGQTFGQTPVSPSPTGFMFGST 482