BLASTX nr result
ID: Mentha25_contig00027686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00027686 (525 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17437.1| hypothetical protein MIMGU_mgv1a008849mg [Mimulus... 57 3e-06 >gb|EYU17437.1| hypothetical protein MIMGU_mgv1a008849mg [Mimulus guttatus] Length = 360 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = -3 Query: 523 IFSALFLHEILHWXXXXXXXXXXXXLYSFLWGRNKEAHIKAQNNLDNSAKEA 368 IFSA+FL E LHW LYSFLWGRN+EA I AQ +D+S +EA Sbjct: 290 IFSAVFLKETLHWGSVLGGGLLISGLYSFLWGRNREARIGAQQKMDSSIEEA 341