BLASTX nr result
ID: Mentha25_contig00027501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00027501 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43611.1| hypothetical protein MIMGU_mgv1a003214mg [Mimulus... 60 2e-07 >gb|EYU43611.1| hypothetical protein MIMGU_mgv1a003214mg [Mimulus guttatus] Length = 599 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 375 SPIKAHFYENATTVANGALDGIYCNGNGLHV 283 SP+KAH YENAT +ANG+LDGIYCNGN LHV Sbjct: 569 SPVKAHIYENATKLANGSLDGIYCNGNSLHV 599