BLASTX nr result
ID: Mentha25_contig00027355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00027355 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20516.1| hypothetical protein MIMGU_mgv1a012668mg [Mimulus... 66 6e-09 ref|XP_007046726.1| Peptide methionine sulfoxide reductase famil... 65 1e-08 ref|XP_006409206.1| hypothetical protein EUTSA_v10022823mg [Eutr... 64 2e-08 ref|XP_007227545.1| hypothetical protein PRUPE_ppa010381mg [Prun... 64 2e-08 ref|XP_002310304.2| peptide methionine sulfoxide reductase famil... 64 2e-08 ref|XP_004134872.1| PREDICTED: peptide methionine sulfoxide redu... 64 3e-08 ref|XP_006298388.1| hypothetical protein CARUB_v10014459mg [Caps... 63 4e-08 ref|XP_003519871.1| PREDICTED: peptide methionine sulfoxide redu... 62 8e-08 ref|XP_004509351.1| PREDICTED: peptide methionine sulfoxide redu... 62 1e-07 ref|XP_006425515.1| hypothetical protein CICLE_v10026355mg [Citr... 61 1e-07 ref|NP_179394.1| peptide methionine sulfoxide reductase A5 [Arab... 61 1e-07 ref|XP_002530748.1| methionine sulfoxide reductase, putative [Ri... 61 1e-07 gb|AFK45762.1| unknown [Medicago truncatula] 61 2e-07 ref|XP_003629340.1| Peptide methionine sulfoxide reductase msrA ... 61 2e-07 gb|EXC35376.1| Peptide methionine sulfoxide reductase A5 [Morus ... 60 2e-07 ref|XP_007156127.1| hypothetical protein PHAVU_003G260900g [Phas... 60 2e-07 ref|XP_003547945.1| PREDICTED: peptide methionine sulfoxide redu... 60 3e-07 ref|XP_004232478.1| PREDICTED: peptide methionine sulfoxide redu... 60 3e-07 ref|XP_006340723.1| PREDICTED: peptide methionine sulfoxide redu... 58 1e-06 ref|XP_002269473.1| PREDICTED: peptide methionine sulfoxide redu... 58 2e-06 >gb|EYU20516.1| hypothetical protein MIMGU_mgv1a012668mg [Mimulus guttatus] Length = 243 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCP R+Q+QID KINDIVRKGWPILREI Sbjct: 211 GYAAELCPTRMQKQIDAKINDIVRKGWPILREI 243 >ref|XP_007046726.1| Peptide methionine sulfoxide reductase family protein [Theobroma cacao] gi|508698987|gb|EOX90883.1| Peptide methionine sulfoxide reductase family protein [Theobroma cacao] Length = 251 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPPR+Q+QID KIN+I+RKGWP+LR++ Sbjct: 219 GYAAELCPPRIQKQIDAKINEIIRKGWPVLRDV 251 >ref|XP_006409206.1| hypothetical protein EUTSA_v10022823mg [Eutrema salsugineum] gi|557110368|gb|ESQ50659.1| hypothetical protein EUTSA_v10022823mg [Eutrema salsugineum] Length = 254 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPPR+Q+QID ++N+I+RKGWP+LR+I Sbjct: 222 GYAAELCPPRIQKQIDARVNEIIRKGWPVLRDI 254 >ref|XP_007227545.1| hypothetical protein PRUPE_ppa010381mg [Prunus persica] gi|462424481|gb|EMJ28744.1| hypothetical protein PRUPE_ppa010381mg [Prunus persica] Length = 252 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPP++QRQID KIN+I++KGWPILR++ Sbjct: 220 GYAAELCPPKIQRQIDAKINEIIKKGWPILRDL 252 >ref|XP_002310304.2| peptide methionine sulfoxide reductase family protein [Populus trichocarpa] gi|118489617|gb|ABK96610.1| unknown [Populus trichocarpa x Populus deltoides] gi|550334845|gb|EEE90754.2| peptide methionine sulfoxide reductase family protein [Populus trichocarpa] Length = 252 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPPR+Q+QI+ KINDI+RKGWP+LR++ Sbjct: 220 GYAAELCPPRIQKQINAKINDILRKGWPVLRDV 252 >ref|XP_004134872.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Cucumis sativus] gi|449491371|ref|XP_004158875.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Cucumis sativus] Length = 252 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILRE 215 GYAAELCPP+ Q+QID KINDI++KGWPILRE Sbjct: 220 GYAAELCPPKTQKQIDAKINDIIKKGWPILRE 251 >ref|XP_006298388.1| hypothetical protein CARUB_v10014459mg [Capsella rubella] gi|482567097|gb|EOA31286.1| hypothetical protein CARUB_v10014459mg [Capsella rubella] Length = 253 Score = 63.2 bits (152), Expect = 4e-08 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPPR+Q+QID ++N+I+RKGWP+LR+I Sbjct: 221 GYAAELCPPRIQKQIDSRVNEIIRKGWPVLRDI 253 >ref|XP_003519871.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Glycine max] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q+QID KINDI++KGWPILR++ Sbjct: 218 GYVAELCPPNIQKQIDAKINDIIKKGWPILRDL 250 >ref|XP_004509351.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Cicer arietinum] Length = 252 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q+QID KIN+I++KGWPILRE+ Sbjct: 220 GYVAELCPPNIQKQIDAKINEIIKKGWPILREL 252 >ref|XP_006425515.1| hypothetical protein CICLE_v10026355mg [Citrus clementina] gi|568825112|ref|XP_006466931.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Citrus sinensis] gi|557527505|gb|ESR38755.1| hypothetical protein CICLE_v10026355mg [Citrus clementina] Length = 245 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 307 YAAELCPPRLQRQIDVKINDIVRKGWPILRE 215 YAAELCPPR+Q+QID KI DI+RKGWPILR+ Sbjct: 214 YAAELCPPRIQKQIDAKIKDIIRKGWPILRD 244 >ref|NP_179394.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] gi|75266015|sp|Q9SL43.1|MSRA5_ARATH RecName: Full=Peptide methionine sulfoxide reductase A5; Short=AtMSRA5; AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; AltName: Full=Protein-methionine-S-oxide reductase; Flags: Precursor gi|4406815|gb|AAD20123.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|27765030|gb|AAO23636.1| At2g18030 [Arabidopsis thaliana] gi|110742978|dbj|BAE99383.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|330251624|gb|AEC06718.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] Length = 254 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPPR+Q+ ID ++N+I+RKGWP+LR+I Sbjct: 222 GYAAELCPPRIQKHIDSRVNEIIRKGWPVLRDI 254 >ref|XP_002530748.1| methionine sulfoxide reductase, putative [Ricinus communis] gi|223529712|gb|EEF31654.1| methionine sulfoxide reductase, putative [Ricinus communis] Length = 253 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYA ELCPP++Q QI+ KINDIVRKGWP+LR++ Sbjct: 221 GYAVELCPPKVQSQIEAKINDIVRKGWPVLRDV 253 >gb|AFK45762.1| unknown [Medicago truncatula] Length = 252 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q+QID KIN+I++KGWPILRE+ Sbjct: 220 GYVAELCPPNIQKQIDAKINEILKKGWPILREL 252 >ref|XP_003629340.1| Peptide methionine sulfoxide reductase msrA [Medicago truncatula] gi|355523362|gb|AET03816.1| Peptide methionine sulfoxide reductase msrA [Medicago truncatula] Length = 252 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q+QID KIN+I++KGWPILRE+ Sbjct: 220 GYVAELCPPNIQKQIDAKINEILKKGWPILREL 252 >gb|EXC35376.1| Peptide methionine sulfoxide reductase A5 [Morus notabilis] Length = 252 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCPP +Q+ ID KINDIV++GWP+LR+I Sbjct: 220 GYAAELCPPEIQKHIDAKINDIVKRGWPMLRDI 252 >ref|XP_007156127.1| hypothetical protein PHAVU_003G260900g [Phaseolus vulgaris] gi|561029481|gb|ESW28121.1| hypothetical protein PHAVU_003G260900g [Phaseolus vulgaris] Length = 261 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q++ID KINDI+++GWPILRE+ Sbjct: 229 GYVAELCPPNIQKRIDAKINDIIKRGWPILREL 261 >ref|XP_003547945.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Glycine max] Length = 250 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GY AELCPP +Q+QID KIN+I++KGWPILR++ Sbjct: 218 GYVAELCPPNIQKQIDAKINNIIKKGWPILRDL 250 >ref|XP_004232478.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Solanum lycopersicum] gi|344227187|gb|AEN03273.1| methionine sulfoxide reductase A5 [Solanum lycopersicum] Length = 252 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELCP R+Q++ID KINDI++KGWPIL+E+ Sbjct: 220 GYAAELCPSRIQKRIDGKINDIIKKGWPILKEV 252 >ref|XP_006340723.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Solanum tuberosum] Length = 252 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 GYAAELC R+Q++ID KINDI++KGWPIL+E+ Sbjct: 220 GYAAELCSSRIQKRIDAKINDIIKKGWPILKEV 252 >ref|XP_002269473.1| PREDICTED: peptide methionine sulfoxide reductase A5 [Vitis vinifera] gi|297735029|emb|CBI17391.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = -1 Query: 310 GYAAELCPPRLQRQIDVKINDIVRKGWPILREI 212 G+AAELCPP++Q+QI+ +I +I+RKGWPILRE+ Sbjct: 220 GFAAELCPPKVQQQINARIEEIIRKGWPILREV 252