BLASTX nr result
ID: Mentha25_contig00026855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00026855 (806 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26387.1| hypothetical protein MIMGU_mgv1a002272mg [Mimulus... 64 8e-08 >gb|EYU26387.1| hypothetical protein MIMGU_mgv1a002272mg [Mimulus guttatus] Length = 692 Score = 63.5 bits (153), Expect = 8e-08 Identities = 35/59 (59%), Positives = 43/59 (72%) Frame = +3 Query: 57 MESPTAFPRFSHQNSKKRTFSGDGSGSSLTACKEVEVLEAPPPEMDRSSKPKLSKEKGV 233 MESPT R+ QNSKKR+F +GSS + CK+ EVLE PPP ++RSSKPK SK+K V Sbjct: 1 MESPTPVSRYIPQNSKKRSFM---AGSSSSGCKDAEVLEIPPP-INRSSKPKSSKQKEV 55