BLASTX nr result
ID: Mentha25_contig00025725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00025725 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40058.1| hypothetical protein MIMGU_mgv1a024669mg, partial... 68 1e-09 >gb|EYU40058.1| hypothetical protein MIMGU_mgv1a024669mg, partial [Mimulus guttatus] Length = 512 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/77 (48%), Positives = 46/77 (59%) Frame = +3 Query: 117 DDIIAANVSVPSFWHKVPDPEHCLGISQPSSLRSDNVYNGRDLGNLISDPPTLEVDVKCL 296 DDI A NVS P+F K+PD E L PSSL SD + + R GN+ S TL+ D K + Sbjct: 5 DDIHAINVSAPAFLRKIPDSELGLEARPPSSLHSDVISDERGFGNMKSISSTLDRDAKPI 64 Query: 297 TQKSGKIERKNGGYIKK 347 Q SGK+ RKN G K+ Sbjct: 65 AQNSGKVVRKNSGSTKR 81